Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1689 IGR1690 IGR1687 IGR1688 IGR1686 IGR1685 glmS, - NG2045 metS,metG, - NG2044 NG2046 NG2043 NG2047 thiC, - NG2041 pilS, - NG2042 glmS, - NG2045 metS,metG, - NG2044 NG2046 NG2043 NG2047 thiC, - NG2041 pilS, - NG2042 Type: tandem, Name:  - 92 glmS, - NG2045 metS,metG, - NG2044 NG2043 NG2047 thiC, - NG2041 pilS, - NG2042 NG2046
* Calculated from Protein Sequence

Gene ID: NG2043

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
glycerate dehydrogenase fragment

Gene Start:
2017062

Gene Stop:
2017373

Gene Length:
312

Molecular Weight*:
11076

pI*:
6.50

Net Charge*:
-0.58

EC:
1.1.1.29  

Functional Class:
Unassigned  

Pathway: pathway table
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism

Secondary Evidence:
Goldberg JD, Yoshida T, Brick P.
Crystal structure of a NAD-dependent D-glycerate dehydrogenase at 2.4 A resolution.
J Mol Biol. 1994 Mar;236(4):1123-40.
PMID: 8120891

Kochhar S, Hunziker PE, Leong-Morgenthaler P, Hottinger H.
Evolutionary relationship of NAD(+)-dependent D-lactate dehydrogenase: comparison of primary structure of 2-hydroxy acid dehydrogenases.
Biochem Biophys Res Commun. 1992 Apr;184(1):60-6.
PMID: 1567457

Comment:
For other 'hpr'genes see NG0314 (hprK ).

Oklahoma ID: NGO.2043

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to glycerate dehydrogenases. Residues 1-103 are 59% similar to residues 210-312 of DHGY_METEX (2494084).

Residues 1-104 are 96% similar to NMA0274 in N.meningitidis (11251638).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1052
COG name: Lactate dehydrogenase and related dehydrogenases
Functional Class:  C,H,R
The phylogenetic pattern of COG1052 is a--KYq-CEBrHuj---l---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002162 (D-isomer specific 2-hydroxyacid dehydrogenase) with a combined E-value of 1.6e-29.
    IPB002162E    60-79


ProDom Summary:  Protein Domain Search
Residues 1-71 are 63% similar to a (NAD DEHYDROGENASE OXIDOREDUCTASE PROTEIN) protein domain (PD000699) which is seen in DHGY_METEX.



Paralogs:  Local Blast Search


NG2043 is paralogously related to NG1336 (D-lactate dehydrogenase) (3e-08).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1MX3|1MX3-A CRYSTAL STRUCTURE OF CTBP DEHYDROGENASE CORE 69.5 2e-13
pdb|1PSD|1PSD-A D-3-PHOSPHOGLYCERATE DEHYDROGENASE 58.9 3e-10
pdb|1DXY|1DXY STRUCTURE OF D-2-HYDROXYISOCAPROATE DEHYDROGENASE 51.5 5e-08
pdb|2DLD|2DLD-A D-LA

Gene Protein Sequence:
MSGENELRQMKPGAVLINCGRGGPVDENALLAALKYGQIGGAGVDVLTEE
PPRGGNPLLNARLPNLIVTPHTAWASREALDRLFEILLANIHAFVKGEAQ
NRVV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGGCGAAAACGAATTGCGGCAGATGAAGCCGGGTGCGGTTTTGAT
CAATTGCGGGCGCGGCGGGCCGGTGGATGAAAACGCGCTGCTTGCCGCAC
TCAAATACGGGCAGATCGGCGGGGCGGGTGTCGATGTTTTGACGGAGGAA
CCGCCGAGGGGCGGCAATCCCTTGCTGAATGCACGATTACCCAATCTGAT
TGTTACGCCGCATACCGCGTGGGCGAGCCGCGAGGCTTTGGATCGGTTGT
TTGAAATATTGTTGGCGAACATTCACGCCTTTGTGAAAGGCGAGGCGCAA
AACCGCGTGGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy