Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Met-3 IGR1681 IGR1683 IGR1678 IGR1676 IGR1679 IGR1677 IGR1682 IGR1680 IGR1684 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 NG2034 ptsI, - NG2038 NG2032 thiC, - NG2041 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 NG2034 ptsI, - NG2038 NG2032 thiC, - NG2041 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 NG2034 ptsI, - NG2038 NG2032 thiC, - NG2041
* Calculated from Protein Sequence

Gene ID: NG2038

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsI  

Definition:
phosphoenolpyruvate-protein phosphotransferase (PtsI)

Gene Start:
2007150

Gene Stop:
2008922

Gene Length:
1773

Molecular Weight*:
64971

pI*:
6.00

Net Charge*:
-8.90

EC:
2.7.3.9  

Functional Class:
Transport and binding proteins; PTS system  

Pathway: pathway table

Secondary Evidence:
De Reuse,H. and Danchin,A.
The ptsH, ptsI, and crr genes of the Escherichia coli
phosphoenolpyruvate-dependent phosphotransferase system: a complex
operon with several modes of transcription.
J. Bacteriol. 170 (9), 3827-3837 (1988)
Medline: 88314869

Saffen,D.W., Presper,K.A., Doering,T.L. and Roseman,S.
Sugar transport by the bacterial phosphotransferase system.
Molecular cloning and structural analysis of the Escherichia coli
ptsH, ptsI, and crr genes.
J. Biol. Chem. 262 (33), 16241-16253 (1987)
Medline: 88058992


Comment:
For other 'pts' genes see NG0313 (ptsN),NG2036 (ptsIIA)and NG2037 (ptsH).

Oklahoma ID: NGO.2038

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to PtsI proteins. Residues 1-574 are 44% similar to PT1_ALCEU (gb|AAA21978).

Residues 1-591 are virtually identical to NMA0392 in N.meningitidis (11260785).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1080
COG name: Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria)
Functional Class:  G
The phylogenetic pattern of COG1080 is --------Eb-h--gpo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000121 (PEP-utilizing enzyme) with a combined E-value of 1.3e-62.
    IPB000121A    79-89
    IPB000121B    183-209
    IPB000121C    293-305
    IPB000121D    359-370
    IPB000121E    397-407
    IPB000121F    439-475
    IPB000121G    504-517
***** IPB002192 (Pyruvate phosphate dikinase, PEP/pyruvate binding domain) with a combined E-value of 6.8e-31.
    IPB002192E    183-209
    IPB002192G    275-306
    IPB002192I    359-368
    IPB002192J    385-410
    IPB002192K    441-475
    IPB002192L    504-521


ProDom Summary:  Protein Domain Search
Residues 162-512 are 46% similar to a (PYRUVATE TRANSFERASE KINASE SYSTEM PHOSPHORYLATION) protein domain (PD000940) which is seen in PT1_ALCEU.

Residues 5-146 are 47% similar to a (SYSTEM PHOSPHOTRANSFERASE ENZYME I TRANSFERASE) protein domain (PD121726) which is seen in PT1_ALCEU.



Paralogs:  Local Blast Search


NG2038 is paralogously related to NG0200 (phosphoenolpyruvate synthase (pyruvate, water dikinase) (PEP synthase)) (2e-23).


Pfam Summary:  Pfam Search
Residues 5 to 130 (E-value = 2.9e-50) place NG2038 in the PEP-utilisers_N family which is described as PEP-utilising enzyme, N-terminal (PF05524)
Residues 151 to 230 (E-value = 1.2e-24) place NG2038 in the PEP-utilizers family which is described as PEP-utilising enzyme, mobile domain (PF00391)
Residues 255 to 550 (E-value = 4.1e-112) place NG2038 in the PEP-utilizers_C family which is described as PEP-utilising enzyme, TIM barrel domain (PF02896)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
36  
63
transmembrane  
72  
88
coil-coil  
241  
268
transmembrane  
443  
459

PDB Hit:
pdb|1EZA|1EZA AMINO TERMINAL DOMAIN OF ENZYME I FROM 139.0 9e-34
pdb|1ZYM|1ZYM-A AMINO TERMINAL DOMAIN OF ENZYME I FROM 139.0 9e-34
pdb|3EZA|3EZA-A COMPLEX OF THE AMINO TERMINAL DOMAIN OF ENZYME I133.0 7e-32
pdb|1JDE|1JDE-A K22A

Gene Protein Sequence:
MSIVLHGVAAGKGIAVGCAHLIARGTEEVPQYDVAQADTDAEAERFDAAV
KATRKELEQLRSAIPENAPTELGAFISLHLMLLTDVTLSREPVDILREQK
INAEWALKQQSDKLAAQFDNMDDAYLRERKQDMLQVVRRIHNNLIGQGNE
LEVADNLFDETVLIANDLSPADTVLFKEQRIAAFVTDAGGPTGHTAILGR
SLDIPSVVGLHNARKLITEGETVIVDGINGVLIISPDESVLNEYRRRARE
YRSHKRDLNKLKKTAAATADGVCIELVGNIESAEDVKPLHNLGADGIGLF
RSEFLYLNRDTMPSEDEQYEVYSAIVKKMKGKSVTIRTVDLGVDKNPRWF
GKNSTPNGSLNPALGMTGIRLCLAEPVMFRTQMRAILRAAVHGPVRMMWP
MITSVSEVRQCLIHLDTAQRQLAERGDAFGEVGIGCMIEIPSAALTVGSI
LKLVDFISVGTNDLIQYILSVDRGDDSVSHLYQPGHPSVLKMLQHVIRTA
NRMDKDVSVCGEMAGDTAFTRVLLGMGLRRFSMNPNNILPVKNIILHSNA
GQLEGDIAKVIRCEDEEKSEKLIKQINSVSVAEEAEVKGRK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTATCGTGCTGCACGGCGTGGCGGCGGGCAAAGGCATTGCCGTCGG
TTGCGCCCACCTGATTGCGCGCGGTACGGAGGAAGTGCCGCAGTATGATG
TTGCTCAGGCGGACACCGATGCCGAAGCCGAACGTTTCGATGCCGCCGTC
AAAGCCACGCGCAAAGAGTTGGAACAGCTCCGCAGCGCGATTCCCGAAAA
CGCCCCGACCGAGTTGGGCGCGTTCATCTCGCTGCACCTGATGCTCTTGA
CCGATGTTACCTTGTCGCGCGAACCCGTCGATATTTTAAGGGAACAAAAA
ATCAACGCCGAGTGGGCATTGAAGCAGCAGAGCGACAAACTCGCCGCCCA
ATTCGACAATATGGACGATGCCTATTTGCGCGAACGCAAGCAGGATATGC
TGCAAGTCGTCCGCCGCATCCACAACAACCTGATCGGGCAGGGCAACGAG
TTGGAGGTTGCCGACAACCTGTTTGACGAAACCGTTCTGATTGCAAACGA
CCTTTCACCCGCCGACACGGTTTTGTTTAAAGAGCAGCGCATTGCCGCCT
TCGTTACCGATGCCGGCGGCCCCACCGGGCATACGGCGATTTTGGGCAGG
AGCTTGGACATCCCGTCCGTCGTCGGGCTGCACAACGCGCGCAAACTGAT
TACCGAAGGCGAAACGGTCATCGTGGACGGCATCAACGGCGTGTTGATTA
TTTCGCCGGATGAGTCGGTGTTGAACGAATACCGCCGCCGCGCCCGCGAA
TACCGCAGCCACAAACGCGATTTGAACAAGCTCAAAAAAACCGCCGCCGC
CACCGCCGACGGGGTCTGCATCGAGCTTGTGGGCAATATAGAATCCGCCG
AAGACGTGAAACCGCTGCACAACCTCGGCGCAGACGGCATCGGGCTGTTC
CGCAGCGAGTTTCTTTACCTGAACCGCGATACGATGCCGTCTGAAGACGA
GCAGTACGAAGTGTACAGCGCGATTGTCAAAAAAATGAAGGGCAAAAGCG
TAACGATACGGACAGTCGATTTGGGTGTGGACAAAAATCCGCGCTGGTTC
GGGAAAAACAGCACGCCCAACGGCAGCCTCAACCCCGCGCTGGGCATGAC
CGGCATCCGCCTGTGCCTTGCCGAACCGGTCATGTTCCGCACGCAGATGC
GCGCCATCCTCCGTGCGGCGGTACACGGCCCCGTCCGCATGATGTGGCCG
ATGATTACCTCCGTATCCGAAGTGCGCCAGTGCCTCATCCACCTCGACAC
CGCGCAACGCCAGCTTGCCGAACGCGGCGATGCCTTCGGCGAAGTCGGCA
TCGGCTGCATGATTGAAATTCCGTCTGCCGCGCTGACCGTCGGCAGTATT
TTGAAACTGGTCGATTTCATCTCCGTCGGTACCAACGATTTGATCCAATA
TATTCTGTCCGTCGATCGCGGCGACGACAGCGTCAGCCATCTCTACCAAC
CCGGACATCCTTCCGTGCTGAAAATGCTGCAACACGTCATCCGTACCGCC
AACCGCATGGACAAAGACGTGTCCGTATGCGGCGAGATGGCGGGCGATAC
CGCGTTTACCCGCGTTTTATTGGGTATGGGGCTGCGCCGTTTTTCCATGA
ATCCGAACAACATCCTGCCCGTCAAAAACATCATTCTGCACAGCAATGCC
GGACAGCTCGAAGGCGATATTGCGAAAGTCATCCGCTGCGAAGACGAAGA
GAAGTCGGAAAAGCTGATCAAACAGATCAACAGCGTGTCTGTCGCGGAAG
AAGCCGAAGTCAAGGGACGGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy