Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Met-3 IGR1681 IGR1683 IGR1678 IGR1676 IGR1679 IGR1677 IGR1682 IGR1680 IGR1675 IGR1684 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petC, - NG2031 NG2034 ptsI, - NG2038 NG2032 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petC, - NG2031 NG2034 ptsI, - NG2038 NG2032 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petC, - NG2031 NG2034 ptsI, - NG2038 NG2032
* Calculated from Protein Sequence

Gene ID: NG2036

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsL  manX  

Definition:
sugar transport PTS system IIA protein

Gene Start:
2006223

Gene Stop:
2006657

Gene Length:
435

Molecular Weight*:
15670

pI*:
5.00

Net Charge*:
-5.18

EC:
2.7.1.69  

Functional Class:
Transport and binding proteins; PTS system  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
Saris,P.E.J., Liljestroem,P. and Palva,E.T.
Nucleotide sequence of manX(ptsL) encoding the enzyme III(Man)
(II-A(Man)) function in the phosphotransferase system of
Escherichia coli K-12. FEMS Microbiol. Lett. 49, 69-73 (1988)

Erni,B., Zanolari,B. and Kocher,H.P.
The mannose permease of Escherichia coli consists of three
different proteins. Amino acid sequence and function in sugar
transport, sugar phosphorylation, and penetration of phage lambda
DNA. J. Biol. Chem. 262 (11), 5238-5247 (1987)
Medline: 87165962

Nunn,R.S., Markovic-Housley,Z., Genovesio-Taverne,J.C.,
Flukiger,K., Rizkallah,P.J., Jansonius,J.N., Schirmer,T. and
Erni,B.
Structure of the IIA domain of the mannose transporter from
Escherichia coli at 1.7 angstroms resolution. J. Mol. Biol. 259 (3), 502-511 (1996)
Medline: 96256525

Markovic-Housley,Z., Balbach,J., Stolz,B. and
Genovesio-Taverne,J.C.
Predicted topology of the N-terminal domain of the hydrophilic
subunit of the mannose transporter of Escherichia coli
FEBS Lett. 340 (3), 202-206 (1994)
Medline: 94178365



Comment:
For other 'pts' genes see NG0313 (ptsN),NG2038 (ptsI)and
NG2037 (ptsH).



Oklahoma ID: NGO.2036

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to PTS system IIAB component sequences. Residues 2-136 are 33% similar to a mannose-specific phosphotransferase system component IIAB in Streptococcus pyogenes (gb|AAK34482).

Residues 1-145 are 97% similar to NMA0390 in N.meningitidis (11353847|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG2036 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 116 (E-value = 5.1e-33) place NG2036 in the EIIA-man family which is described as PTS system fructose IIA component (PF03610)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1PDO|1PDO PHOSPHOENOLPYRUVATE-DEPENDENT PHOSPHOTRANSFERASE 190.0 1e-49

Gene Protein Sequence:
MIGLLIITHETIGEAYRKLAHHFFPGGLPENVRILGVQPTEDQDDIINNA
ISALQEFPENHGVLIMTDIFGATPCNAARRLVRENKSAILTGLNAPMMIK
AVQYSPAAEDLAAFTECVREAAVKGIFAITSAPEDLVCRRSGDAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAGGGCTTTTAATCATCACACACGAAACCATAGGCGAAGCCTACCG
CAAGCTGGCGCATCATTTTTTTCCGGGCGGGCTGCCTGAAAACGTCCGCA
TACTCGGCGTGCAGCCGACGGAAGACCAAGACGACATTATCAACAACGCC
ATTTCCGCGCTGCAAGAGTTTCCTGAAAACCACGGTGTATTGATTATGAC
CGACATCTTCGGCGCGACCCCCTGCAATGCCGCCCGCCGGCTCGTGCGCG
AAAACAAATCGGCGATTTTGACCGGGCTGAACGCGCCGATGATGATTAAG
GCCGTCCAATATTCGCCGGCGGCGGAAGACCTTGCCGCCTTTACCGAATG
CGTCAGAGAGGCGGCGGTAAAAGGCATTTTCGCCATCACGTCCGCGCCCG
AAGATTTGGTGTGCCGGCGCAGCGGCGATGCCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy