Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1674 IGR1681 IGR1683 IGR1678 IGR1676 IGR1679 IGR1677 IGR1682 IGR1680 IGR1675 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petC, - NG2031 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petC, - NG2031 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032 petC, - NG2031
* Calculated from Protein Sequence

Gene ID: NG2035

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hpt  

Definition:
hypoxanthine phosphoribosyltransferase

Gene Start:
2005576

Gene Stop:
2006136

Gene Length:
561

Molecular Weight*:
20738

pI*:
5.10

Net Charge*:
-4.42

EC:
2.4.2.8  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Nilsson,D. and Lauridsen,A.A.
Isolation of purine auxotrophic mutants of Lactococcus lactis and
characterization of the gene hpt encoding hypoxanthine guanine
phosphoribosyltransferase. Mol. Gen. Genet. 235 (2-3), 359-364 (1992)
Medline: 93101141

Showalter,R.E. and Silverman,M.R.
Nucleotide sequence of a gene, hpt, for hypoxanthine
phosphoribosyltransferase from Vibrio harveyi
Nucleic Acids Res. 18 (15), 4621 (1990)
Medline: 90356428


Comment:
Oklahoma ID: NGO.2035

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to hypoxanthine-guanine phosphoribosyltransferase sequences. Residues 18-186 are 40% similar to the enzyme in P.aeruginosa (gb|AAG08032).

Residues 1-187 are virtually identical to NMB2047 in N.meningitidis (gb|AAF42367).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0634
COG name: Hypoxanthine-guanine phosphoribosyltransferase
Functional Class:  F
The phylogenetic pattern of COG0634 is -----qv-ebrh--gp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG2035 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 160 (E-value = 4.7e-11) place NG2035 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
41
transmembrane  
48  
64

PDB Hit:
pdb|1HGX|1HGX-A HYPOXANTHINE-GUANINE-XANTHINE 78.0 1e-15
pdb|1TC1|1TC1-A A 1.4 ANGSTROM CRYSTAL STRUCTURE FOR THE 69.5 4e-13
pdb|1TC2|1TC2-A TERNARY SUBSTRATE COMPLEX OF THE HYPOXANTHINE 69.5 4e-13
pdb|1I14|1I14-A ANAL

Gene Protein Sequence:
MTDLETKRLETQAMLENADLLFDQGQCRAALQKVADEITRDLGDKYPLLL
PVMGGAVVFTGQLLPLLRFPLDFDYVHVSRYGDKLEGGAFNWKRMPDAEQ
IRGRHVVVLDDILDEGHTMSAIQAKLLEMGAASCRAAVFANKLIDKEKPV
KADYVGLDVPNRYVFGYGMDAAGCWRNLGEIYALGGK

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGATTTAGAAACCAAACGCCTTGAAACACAGGCGATGCTTGAAAA
CGCCGATCTTTTGTTCGACCAAGGCCAATGCCGTGCCGCACTGCAAAAAG
TGGCGGACGAGATTACGCGTGATTTGGGGGATAAATATCCGTTGCTGCTG
CCCGTGATGGGCGGCGCGGTGGTGTTTACGGGGCAGTTGCTGCCGCTGTT
GCGTTTTCCCTTAGATTTTGATTATGTTCACGTTTCCCGTTACGGCGACA
AGCTGGAGGGCGGCGCGTTCAACTGGAAGCGTATGCCCGATGCGGAACAA
ATCCGGGGCAGGCACGTGGTCGTGTTGGACGATATTTTGGACGAAGGGCA
TACGATGTCCGCCATTCAAGCCAAACTTTTGGAAATGGGTGCGGCAAGCT
GCCGTGCGGCGGTGTTCGCCAATAAATTAATCGACAAAGAAAAACCGGTC
AAAGCCGATTATGTCGGACTGGATGTGCCGAACCGTTATGTTTTCGGTTA
CGGCATGGATGCGGCAGGCTGCTGGCGCAATTTGGGCGAGATTTACGCAT
TGGGCGGAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy