Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1674 IGR1681 IGR1683 IGR1678 IGR1676 IGR1679 IGR1677 IGR1682 IGR1680 IGR1675 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petC, - NG2031 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032 NG2033 NG2040 potA, - NG2039 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petC, - NG2031 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032 NG2033 potA, - NG2039 NG2040 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petC, - NG2031 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032
* Calculated from Protein Sequence

Gene ID: NG2034

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
DNA ligase

Gene Start:
2004683

Gene Stop:
2005504

Gene Length:
822

Molecular Weight*:
30747

pI*:
10.90

Net Charge*:
20.35

EC:
6.5.1.1  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Cheng,C. and Shuman,S.
Characterization of an ATP-dependent DNA ligase encoded by
Haemophilus influenzae
Nucleic Acids Res. 25 (7), 1369-1374 (1997)
Medline: 97214029

Preston,A., Maskell,D., Johnson,A. and Moxon,E.R.
Altered lipopolysaccharide characteristic of the I69 phenotype in
Haemophilus influenzae results from mutations in a novel gene, isn
J. Bacteriol. 178 (2), 396-402 (1996)
Medline: 96134971



Comment:
This enzyme catalyzes efficient strand joining on a single nicked DNA.

Oklahoma ID: NGO.2034

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to DNA ligases. Residues 25-269 are 52% similar to DNLI_HAEIN (gb|AAA95982).

Residues 13-274 are virtually identical to NMA0388 in N.meningitidis (11354073|).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1793
COG name: ATP-dependent DNA ligase
Functional Class:  L
The phylogenetic pattern of COG1793 is AmtkYq---BR----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000977 (ATP-dependent DNA ligase) with a combined E-value of 1.3e-06.
    IPB000977A    24-31
    IPB000977B    46-55
    IPB000977C    110-119
    IPB000977D    185-198
    IPB000977E    199-210
    IPB000977F    259-274


ProDom Summary:  Protein Domain Search
Residues 25-269 are 52% similar to a (DNA LIGASE EC 6.5.1.1) protein domain (PD123890) which is seen in DNLI_HAEIN.



Paralogs:  Local Blast Search


NG2034 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 24 to 193 (E-value = 1.1e-14) place NG2034 in the DNA_ligase_A_M family which is described as ATP dependent DNA ligase domain (PF01068)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
24

PDB Hit:
pdb|1FVI|1FVI-A CRYSTAL STRUCTURE OF CHLORELLA VIRUS DNA 49.2 9e-07

Gene Protein Sequence:
VIKKIIGGIIPIFTAVFIPASAGAADLMLAQEYKGQDIAGWAMSEKLDGV
RAYWDGKHLISRQGYAFTPPKGFTAQFPPYPLDGELYSGRGQFEQISATV
RSVSSDWRGIRLHVFDVPKAQGNLYQRLAVATQWLKTHPNAPITIIPQIK
VRDRRHAMDFLKQIEVQGGEGVMLRQPESRYSGGRSSQLLKLKSQYDDEC
TVTRHYEGKGRNAGRLGAVGCKNRHGEFRIGSGFKDKDRDNPPKIGTLIT
YRYRGFTRKGTPKFATFVRVRTDR

Gene Nucleotide Sequence:  Sequence Viewer
GTGATTAAGAAGATAATCGGCGGCATCATACCGATTTTTACGGCGGTTTT
CATCCCTGCATCGGCAGGCGCGGCGGATTTGATGCTGGCGCAGGAATACA
AAGGGCAGGACATTGCCGGCTGGGCGATGAGCGAGAAACTCGACGGCGTG
CGCGCCTATTGGGACGGAAAGCACCTGATAAGCCGTCAGGGCTACGCGTT
TACGCCCCCCAAAGGCTTTACCGCGCAGTTTCCGCCTTATCCTTTGGACG
GCGAATTGTATAGCGGGCGCGGTCAGTTCGAGCAGATTTCCGCTACCGTG
CGTTCTGTTTCTTCAGACTGGCGCGGCATCCGCCTGCACGTTTTCGATGT
ACCCAAGGCGCAGGGCAACCTCTACCAACGTTTGGCAGTCGCAACGCAGT
GGCTGAAAACGCATCCGAACGCGCCGATTACCATCATCCCGCAAATCAAA
GTGCGCGACCGGCGGCACGCGATGGACTTTTTAAAACAAATCGAAGTGCA
GGGCGGCGAAGGCGTGATGCTGCGCCAGCCCGAATCCCGTTACAGCGGCG
GCAGGAGCAGCCAATTATTGAAGCTGAAAAGCCAATACGACGACGAATGC
ACGGTAACGCGGCACTATGAGGGCAAAGGGCGAAACGCCGGACGGCTGGG
CGCGGTCGGCTGCAAAAACCGACACGGCGAATTCCGCATCGGCAGCGGTT
TCAAGGACAAAGACCGCGACAATCCGCCCAAAATCGGCACGCTGATTACC
TACCGTTACCGTGGCTTTACGCGGAAAGGCACGCCGAAATTTGCCACATT
TGTGCGCGTGCGTACCGACCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy