Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1681 IGR1674 IGR1673 IGR1678 IGR1676 IGR1679 IGR1677 IGR1672 IGR1671 IGR1680 IGR1675 NG2033 metR, - NG2027 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032 NG2033 metR, - NG2027 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032 NG2033 metR, - NG2027 ptsH, - NG2037 ptsL,manX, - NG2036 hpt, - NG2035 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 ptsI, - NG2038 NG2032
* Calculated from Protein Sequence

Gene ID: NG2032

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
2002101

Gene Stop:
2003888

Gene Length:
1788

Molecular Weight*:
66965

pI*:
5.00

Net Charge*:
-19.06

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.2032

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to hypotheticals and possible periplasmic proteins. Residues 173-595 are 41% similar to residues 46-463 of YIGN_ECOLI (gb|AAC76835).

Residues 1-595 are 93% similar to NMA0386 in N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1322
COG name: Uncharacterized BCR, YigN family
Functional Class:  S
The phylogenetic pattern of COG1322 is --------e--h------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 91-310 are 28% similar to a (PROTEIN NUCLEAR DNA-BINDING REPEAT TRANSCRIPTION) protein domain (PD001830) which is seen in Q25893_PLAFA.

Residues 241-571 are 46% similar to a (PROTEIN YIGN FAMILY UDP-UBIE INTERGENIC REGION PRECURSOR) protein domain (PD041459) which is seen in YIGN_ECOLI.

Residues 70-298 are 29% similar to a (PROTEIN COILED COIL REPEAT FILAMENT HEPTAD PATTERN CHAIN) protein domain (PD000002) which is seen in Q25893_PLAFA.



Paralogs:  Local Blast Search


NG2032 is paralogously related to NG1443 (probable chromosome segregation protein) (2e-08) and NG0571 (conserved hypothetical protein (possible membrane protein)) (0.001).


Pfam Summary:  Pfam Search
Residues 262 to 570 (E-value = 5.2e-146) place NG2032 in the RmuC family which is described as RmuC family (PF02646)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
54
coil-coil  
46  
125
coil-coil  
137  
263
coil-coil  
287  
328
coil-coil  
521  
548

PDB Hit:
pdb|1I84|1I84-S CRYO-EM STRUCTURE OF THE HEAVY MEROMYOSIN 60.9 6e-10
pdb|1DG3|1DG3-A STRUCTURE OF HUMAN GUANYLATE BINDING PROTEIN-1 42.2 2e-04
pdb|2TMA|2TMA-A TROPOMYOSIN 41.8 3e-04
pdb|1I84|1I84-S CRYO

Gene Protein Sequence:
MELMTVLLPLAALVSGVLFTWLLMKGRFQGEFAGLNAQLAEKAARCDFIE
QAHAEIASELAALDGKYEHLQDENYALSNRFSAAEKQIAHLQEKEAESVR
LKQSYIDLQEKAQGLAVENERLATQLGQERKAFAEQYALERQIRQRVETD
LEESRQTVRDVQNDLSDVGNRFAAAEKQIAYLQEKEAEAERLRQSHTELQ
EKAQGLAVENERLATQIEQERLASEEKLSLLGEARKSLSDQFQNLANTIL
EEKSRRFTEQNREQLHQVLNPLNERIHGFGELVRQTYDKESRERLTLENE
LKRLQGLNAQLHSEAKALTNALTGTQNKVQGNWGEMILETVLENSGLQKG
REYVVQAASVRKEEDGGTRRLQPDVLVNLPDNKQIVIDSKVSLTAYVRYT
QAADADEAARELAAYIASIRAHMKGLSLKDYTDLEGVNTLDFVFMFIPVE
PAYLLALQNDAGLFQECFDKRIMLVGPSTLLATLRTVANIWRNEQQNQNA
LAIADEGGKLYDKFVGFVQTLESVGKGIDQAQNSFQTAFKQLAEGRGNLV
GRAEKLRLLGVKAGKQLQRDLVERANEQTAFALGKPSEQEAADEAE

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGCTGATGACTGTTTTGCTGCCTTTGGCGGCGTTGGTGTCGGGCGT
GTTGTTTACATGGTTGCTGATGAAGGGCAGGTTTCAGGGCGAGTTTGCCG
GTTTGAACGCGCAATTGGCGGAAAAGGCGGCAAGATGTGATTTTATTGAA
CAGGCACACGCAGAAATTGCATCAGAATTGGCCGCTTTGGATGGGAAATA
CGAGCATTTGCAGGACGAAAATTATGCTTTGAGCAACCGTTTTTCCGCAG
CCGAAAAGCAGATTGCCCATTTGCAGGAAAAAGAGGCGGAATCGGTTCGG
TTGAAGCAGTCGTATATCGATTTGCAGGAAAAGGCGCAGGGTTTGGCGGT
TGAAAACGAACGTTTGGCAACGCAGCTCGGGCAGGAACGGAAGGCGTTTG
CCGAGCAATATGCGCTGGAACGCCAAATCCGCCAAAGAGTCGAAACCGAT
TTGGAAGAAAGCCGCCAAACTGTCCGCGACGTGCAAAACGACCTTTCCGA
TGTCGGCAACCGTTTTGCCGCAGCCGAAAAACAGATTGCCTATTTGCAGG
AAAAAGAGGCGGAAGCGGAGCGGTTGAGGCAGTCGCATACCGAGTTGCAG
GAAAAGGCGCAGGGTTTGGCGGTTGAAAACGAACGTTTGGCAACGCAAAT
CGAACAGGAACGCCTTGCTTCTGAAGAAAAGCTGTCCTTGCTGGGCGAGG
CGCGCAAAAGCTTGAGCGATCAGTTTCAAAATCTTGCCAACACGATTTTG
GAAGAAAAAAGCCGCCGTTTTACCGAGCAGAACCGCGAGCAGCTCCATCA
GGTTTTGAACCCGTTGAACGAACGCATCCACGGTTTCGGCGAGTTGGTCA
GGCAAACTTATGATAAAGAATCGCGCGAGCGGCTGACTTTGGAAAACGAA
TTGAAACGGCTCCAAGGGTTGAATGCGCAGCTGCACAGCGAGGCAAAGGC
CCTGACCAACGCGCTGACCGGCACGCAGAACAAGGTTCAGGGCAATTGGG
GCGAGATGATTCTGGAAACGGTTTTGGAAAATTCCGGCCTTCAGAAAGGG
CGGGAATATGTGGTTCAGGCGGCATCCGTCCGAAAAGAGGAAGACGGCGG
CACGCGCCGCCTCCAGCCCGACGTTTTGGTCAACCTGCCCGACAACAAGC
AGATTGTCATTGATTCCAAGGTTTCGCTGACGGCTTATGTGCGCTACACG
CAGGCGGCGGATGCGGATGAGGCGGCACGCGAACTGGCGGCGTATATCGC
CAGCATACGCGCGCATATGAAAGGCTTGTCGCTGAAGGATTACACCGATT
TGGAAGGTGTGAACACATTGGATTTCGTCTTTATGTTTATCCCTGTCGAA
CCGGCCTACCTGCTGGCGTTGCAGAATGACGCGGGCTTGTTCCAAGAGTG
TTTCGACAAACGGATTATGCTGGTCGGCCCCAGTACGCTGCTGGCGACTT
TGCGGACGGTGGCGAATATTTGGCGCAACGAGCAGCAAAACCAAAACGCG
CTGGCGATTGCGGACGAAGGCGGCAAGCTGTACGACAAGTTTGTCGGCTT
CGTACAGACGCTCGAAAGCGTCGGCAAAGGCATCGATCAGGCGCAAAACA
GCTTTCAGACGGCATTCAAGCAACTTGCCGAGGGACGCGGGAATCTGGTC
GGACGCGCCGAGAAACTGCGTCTGTTGGGCGTGAAGGCAGGCAAACAGCT
TCAACGGGATTTGGTCGAGCGTGCCAACGAACAGACGGCATTTGCTTTGG
GCAAACCTTCGGAACAGGAAGCGGCTGACGAAGCCGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy