Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1674 IGR1673 IGR1678 IGR1676 IGR1679 IGR1677 IGR1672 IGR1671 IGR1670 IGR1675 IGR1669 NG2026 NG2033 metR, - NG2027 ptsL,manX, - NG2036 hpt, - NG2035 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 NG2032 NG2026 NG2033 metR, - NG2027 ptsL,manX, - NG2036 hpt, - NG2035 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 NG2032 NG2026 NG2033 metR, - NG2027 hpt, - NG2035 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 NG2032 ptsL,manX, - NG2036
* Calculated from Protein Sequence

Gene ID: NG2031

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
petC  

Definition:
cytochrome C1 precursor

Gene Start:
2000966

Gene Stop:
2001766

Gene Length:
801

Molecular Weight*:
30486

pI*:
9.70

Net Charge*:
6.83

EC:
1.10.2.2  

Functional Class:
Energy metabolism; Aerobic respiration  
Energy metabolism; Electron transport  

Pathway: pathway table
Electron Transport System, Complex III
Oxidative phosphorylation

Secondary Evidence:
Majewski,C. and Trebst,A.
The pet genes of Rhodospirillum rubrum: cloning and sequencing of
the genes for the cytochrome bc1-complex
Mol. Gen. Genet. 224 (3), 373-382 (1990)
Medline: 91094774

Mayes SR, Barber J.
Primary structure of the psbN-psbH-petC-petA gene cluster of the cyanobacterium Synechocystis PCC 6803.
Plant Mol Biol. 1991 Aug;17(2):289-93. No abstract available.
PMID: 1907512

Davidson E, Daldal F.
Primary structure of the bc1 complex of Rhodopseudomonas capsulata. Nucleotide sequence of the pet operon encoding the Rieske cytochrome b, and cytochrome c1 apoproteins.
J Mol Biol. 1987 May 5;195(1):13-24.
PMID: 2821268

Daldal F, Davidson E, Cheng S.
Isolation of the structural genes for the Rieske Fe-S protein, cytochrome b and cytochrome c1 all components of the ubiquinol:
cytochrome c2 oxidoreductase complex of Rhodopseudomonas capsulata.
J Mol Biol. 1987 May 5;195(1):1-12.
PMID: 2821266


Comment:
For other 'pet' genes see NG2029 (petA) and NG2030 (petB).

Oklahoma ID: NGO.2031



Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to cytochrome C1 precursors. Residues 10-267 are 44% similar to cytochrome C1 in V.cholerae (gb|AAF93743).

Residues 1-267 are virtually identical to NMB2051 in N.meningitidis (gb|AAF42371).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** PR00603 (Cytochrome C1 signature) with a combined E-value of 4.2e-11.
    PR00603A    32-51
    PR00603B    52-71
    PR00603D    113-137
    PR00603G    212-231
    PR00603H    231-246


ProDom Summary:  Protein Domain Search
Residues 44-147 are 32% similar to a (HEME C1 CYTOCHROME ELECTRON) protein domain (PD004444) which is seen in CY1_RHORU.

Residues 10-267 are 44% similar to a (CYTOCHROME C1 PRECURSOR ELECTRON) protein domain (PD119085) which is seen in CY1_CHRVI.



Paralogs:  Local Blast Search


NG2031 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 34 to 267 (E-value = 4e-11) place NG2031 in the Cytochrom_C1 family which is described as Cytochrome C1 family (PF02167)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
25
cleavable N-terminal sequence  
1  
28
transmembrane  
242  
258

PDB Hit:
pdb|1BCC|1BCC-D CYTOCHROME BC1 COMPLEX FROM CHICKEN 65.2 1e-11
pdb|1BE3|1BE3-D CYTOCHROME BC1 COMPLEX FROM BOVINE 64.8 2e-11
pdb|1KYO|1KYO-D YEAST CYTOCHROME BC1 COMPLEX WITH BOUND 54.3 2e-08
pdb|1EZV|1EZV-D STRU

Gene Protein Sequence:
MRAVEMKQAMKNWFAALLSAVPMSAAFASGGHAHYEKVDIDLRDQVSLQR
GAQIFTNYCLSCHSASGMRFNRLKDIGLTDEEIKKNLMFTTDNVGDVMHS
AMNPKDAAKWFGAAPPDLTLIARSKGADYLYAYMRGFYKDPTRPSGWNNT
VFDKVGMPHPLWEQQGVQAVELDAKGQPVMVKDEHGEMKPKLYWESTGLH
SRRLPNGKVIQKEYDAYVRDLVNYLVYMGEPAQLQRKRIGYVVMIFLFAV
MLPLAYFLKKEYWKDVH

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGGCAGTCGAAATGAAACAAGCTATGAAGAATTGGTTTGCTGCCTT
GCTGTCGGCAGTACCCATGAGTGCGGCATTTGCTTCGGGCGGTCATGCAC
ACTATGAGAAAGTCGATATTGATTTGCGCGACCAAGTAAGCTTGCAGCGC
GGCGCACAAATCTTTACCAACTACTGTTTGTCCTGCCACTCGGCAAGCGG
TATGCGTTTCAACCGTTTGAAAGACATCGGTCTGACTGATGAAGAAATCA
AGAAAAACCTGATGTTTACCACCGATAATGTCGGCGATGTCATGCATTCG
GCGATGAACCCGAAAGATGCGGCAAAATGGTTTGGTGCTGCTCCGCCCGA
TTTGACATTGATTGCGCGTTCCAAAGGTGCAGACTACCTTTACGCTTATA
TGCGCGGCTTCTATAAAGATCCGACCCGTCCGAGCGGCTGGAACAATACT
GTATTCGATAAAGTCGGTATGCCCCACCCGTTGTGGGAACAGCAAGGCGT
TCAAGCCGTTGAGTTGGATGCCAAAGGTCAGCCGGTTATGGTAAAAGACG
AACACGGCGAGATGAAGCCTAAGCTGTATTGGGAATCTACCGGTTTGCAC
AGCCGCCGTCTGCCTAACGGCAAAGTGATCCAGAAAGAGTACGACGCATA
TGTACGCGATTTGGTCAATTACCTTGTGTACATGGGCGAACCTGCACAAC
TGCAACGCAAACGTATAGGCTATGTCGTGATGATTTTCCTATTTGCGGTT
ATGCTGCCTTTGGCGTATTTCCTGAAAAAAGAATATTGGAAAGACGTACA
C


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy