Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1674 IGR1668 IGR1673 IGR1676 IGR1677 IGR1672 IGR1671 IGR1670 IGR1675 IGR1669 NG2026 NG2033 metR, - NG2027 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 NG2032 NG2026 NG2033 metR, - NG2027 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 NG2032 NG2026 NG2033 metR, - NG2027 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 NG2034 petB,qcrB, - NG2030 NG2032 rpsI, - NG2025
* Calculated from Protein Sequence

Gene ID: NG2030

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
petB  qcrB  

Definition:
apocytochrome B

Gene Start:
1999617

Gene Stop:
2000963

Gene Length:
1347

Molecular Weight*:
50291

pI*:
10.20

Net Charge*:
11.11

EC:
1.10.2.2  

Functional Class:
Energy metabolism; Aerobic respiration  
Energy metabolism; Electron transport  

Pathway: pathway table
Electron Transport System, Complex III
Oxidative phosphorylation

Secondary Evidence:
Majewski,C. and Trebst,A.
The pet genes of Rhodospirillum rubrum: cloning and sequencing of
the genes for the cytochrome bc1-complex
Mol. Gen. Genet. 224 (3), 373-382 (1990)
Medline: 91094774

Sone N, Tsuchiya N, Inoue M, Noguchi S.
Bacillus stearothermophilus qcr operon encoding rieske FeS protein, cytochrome b6, and a novel-type cytochrome c1 of
quinol-cytochrome c reductase.
J Biol Chem. 1996 May 24;271(21):12457-62.
PMID: 8647852

Kruip J, Nixon PJ, Osiewacz HD, Rogner M.
Nucleotide sequence of the petB gene encoding cytochrome b6 from the mesophilic cyanobacterium Synechocystis PCC 6803:
implications for evolution and function.
Biochim Biophys Acta. 1994 Dec 30;1188(3):443-6.
PMID: 7803459


Comment:
For other 'pet' genes see NG2029 (petA) and NG2031 (petC).


Oklahoma ID: NGO.2030

Other subunits in the complex are the Rieske protein (NG2029) and cytochrome C1 (NG2031).

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to apocytochrome b sequences. Residues 13-421 are 65% similar to the protein from P.aeruginosa (gb|AAG07818).

Residues 1-449 are 89% similar to NMB2052 in N.meningitidis (gb|AAF42372).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1290
COG name: Cytochrome b (b6-like)
Functional Class:  C
The phylogenetic pattern of COG1290 is -----q-C-br-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000179 (Cytochrome b/b6) with a combined E-value of 9.7e-93.
    IPB000179A    66-120
    IPB000179B    170-224
    IPB000179C    284-328
    IPB000179D    350-398
    IPB000179A    13-67


ProDom Summary:  Protein Domain Search
Residues 36-270 are 44% similar to a (PROTEIN MITOCHONDRION TRANSMEMBRANE OXIDOREDUCTASE NAD) protein domain (PD000148) which is seen in CYB_APILI.

Residues 218-254 are 63% similar to a (CYTOCHROME B ELECTRON TRANSPORT) protein domain (PD151744) which is seen in CYB_CHRVI.

Residues 255-290 are 69% similar to a (CYTOCHROME B ELECTRON TRANSPORT) protein domain (PD195902) which is seen in CYB_CHRVI.

Residues 13-51 are 66% similar to a (CYTOCHROME B ELECTRON TRANSPORT) protein domain (PD056179) which is seen in CYB_CHRVI.

Residues 45-330 are 22% similar to a (CYTOCHROME B ELECTRON TRANSPORT) protein domain (PD138485) which is seen in CYB_PARTE.

Residues 12-133 are 36% similar to a (CYTOCHROME B) protein domain (PD077285) which is seen in O66459_AQUAE.

Residues 53-126 are 68% similar to a (CYTOCHROME B MITOCHONDRION ELECTRON TRANSPORT) protein domain (PD000016) which is seen in CYB_CHRVI.

Residues 134-185 are 67% similar to a (CYTOCHROME MITOCHONDRION B ELECTRON TRANSPORT) protein domain (PD000017) which is seen in CYB_CHRVI.

Residues 293-398 are 49% similar to a (CYTOCHROME B MITOCHONDRION ELECTRON) protein domain (PD000019) which is seen in CYB_CHRVI.



Paralogs:  Local Blast Search


NG2030 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 226 (E-value = 1.6e-84) place NG2030 in the Cytochrom_B_N family which is described as Cytochrome b(N-terminal)/b6/petB (PF00033)
Residues 292 to 398 (E-value = 1.1e-09) place NG2030 in the Cytochrom_B_C family which is described as Cytochrome b(C-terminal)/b6/petD (PF00032)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
48  
64
transmembrane  
106  
122
transmembrane  
132  
148
transmembrane  
161  
177
transmembrane  
204  
220
transmembrane  
260  
276
transmembrane  
326  
342
non-globular  
357  
411
transmembrane  
365  
381
transmembrane  
388  
404
transmembrane  
429  
445

PDB Hit:
pdb|1BE3|1BE3-C CYTOCHROME BC1 COMPLEX FROM BOVINE 293.0 6e-80
pdb|1QCR|1QCR-C CRYSTAL STRUCTURE OF BOVINE MITOCHONDRIAL 293.0 6e-80
pdb|1BCC|1BCC-C CYTOCHROME BC1 COMPLEX FROM CHICKEN 282.0 7e-77
pdb|1EZV|1EZV-C STRU

Gene Protein Sequence:
MANQTNSKAKALLGWMDARFPLSKMWNEHLAQYYAPKNFNFWYYFGSLAL
LVLVIQIVSGIFLTMNYKPDGNLNAYHLPAAFTAVEYIMRDVSGGWIIRY
MHSTGASFFFIVVYLHMFRGLIYGSYKKPRELVWIFGSLIFLALMAEAFM
GYLLPWGQMSFWGAQVIINLFSAIPVIGPDLSTWIRGDFNVSDVTLNRFF
ALHVIAVPLVLLGLVVAHIIALHEVGSNNPDGVEIKKNKDENGIPRDGIP
FHPYYTVKDILGVVVFLIVFCAVLFFAPEGGGYFLEAPNFDAANALKTPP
HIAPVWYFTPFYAILRAIPSFLGTQVWGVIGMGAAVVLIALLPWLDRGEV
KSVRYRGPIFKTALVLFIISFIGLGILGAMVATDTRTLVARILSFVYFAF
FLGMPFYTKLDKNKPVPERVTMSTAKQKIMFFVYVGITAVGAYLFATNI

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAACCAAACCAATAGCAAAGCAAAAGCATTGTTAGGCTGGATGGA
CGCTCGCTTCCCCCTGTCTAAAATGTGGAATGAGCATTTGGCGCAATACT
ATGCGCCGAAAAACTTTAATTTTTGGTACTATTTCGGCTCTTTAGCCCTG
CTCGTCCTCGTGATTCAAATCGTCAGCGGTATTTTCCTGACGATGAACTA
CAAACCGGACGGCAACCTGAATGCCTACCATCTGCCTGCTGCCTTTACCG
CAGTAGAGTACATCATGCGCGACGTGTCCGGCGGTTGGATTATCCGCTAC
ATGCACTCCACCGGCGCATCTTTCTTCTTCATTGTTGTTTATCTGCACAT
GTTCCGTGGTTTGATTTACGGTTCATATAAAAAACCGCGCGAATTGGTGT
GGATTTTCGGTTCTTTGATCTTCTTGGCATTGATGGCGGAAGCCTTTATG
GGCTACCTGCTGCCTTGGGGTCAGATGTCCTTTTGGGGTGCGCAGGTGAT
TATCAACCTGTTCTCCGCCATTCCCGTCATCGGTCCTGATTTGTCCACTT
GGATTCGCGGCGACTTCAACGTTTCCGACGTTACCCTGAACCGCTTCTTC
GCCCTGCACGTTATCGCCGTACCGCTGGTATTGCTCGGTTTAGTCGTGGC
ACACATCATCGCACTGCACGAAGTGGGCTCTAACAACCCCGACGGTGTGG
AAATCAAGAAAAACAAAGATGAAAACGGCATTCCGCGCGACGGCATCCCG
TTCCACCCTTACTACACTGTTAAAGACATCCTGGGCGTCGTTGTATTCCT
GATTGTCTTCTGTGCCGTATTGTTCTTTGCCCCTGAAGGCGGCGGCTACT
TCCTCGAAGCGCCGAACTTCGATGCGGCAAATGCGCTGAAAACACCCCCG
CACATTGCGCCGGTATGGTATTTCACACCGTTCTACGCCATTTTGCGTGC
GATTCCTTCCTTCTTGGGAACGCAGGTTTGGGGTGTAATCGGTATGGGCG
CGGCGGTCGTGTTGATTGCCCTGCTGCCTTGGCTGGACAGGGGCGAGGTG
AAATCCGTCCGTTACCGCGGTCCGATTTTCAAAACCGCATTGGTCTTGTT
CATCATTTCCTTTATCGGTTTGGGTATTTTGGGCGCGATGGTGGCAACCG
ATACGCGTACTTTGGTCGCGCGCATCCTGTCCTTCGTCTATTTCGCATTC
TTCCTGGGTATGCCGTTCTATACCAAGCTGGATAAAAACAAACCGGTTCC
CGAACGCGTAACCATGAGCACCGCCAAACAAAAAATCATGTTCTTTGTTT
ACGTCGGCATTACTGCCGTGGGTGCTTACCTGTTTGCAACCAACATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy