Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1674 IGR1666 IGR1668 IGR1673 IGR1676 IGR1672 IGR1671 IGR1670 IGR1675 IGR1667 IGR1669 NG2026 NG2033 metR, - NG2027 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 petB,qcrB, - NG2030 NG2032 NG2026 NG2033 metR, - NG2027 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 petB,qcrB, - NG2030 NG2032 NG2026 NG2033 metR, - NG2027 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 petB,qcrB, - NG2030 NG2032 NG2023
* Calculated from Protein Sequence

Gene ID: NG2029

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
petA  

Definition:
ubiquinol--cytochrome c reductase iron-sulfur subunit (Rieske iron sulfur protein, RISP)

Gene Start:
1999017

Gene Stop:
1999595

Gene Length:
579

Molecular Weight*:
20633

pI*:
5.40

Net Charge*:
-2.76

EC:
1.10.2.2  

Functional Class:
Energy metabolism; Aerobic respiration  
Energy metabolism; Electron transport  

Pathway: pathway table
Electron Transport System, Complex III
Oxidative phosphorylation

Secondary Evidence:
Emmermann,M., Clericus,M., Braun,H.P., Mozo,T., Heins,L., Kruft,V.
and Schmitz,U.K.
Molecular features, processing and import of the Rieske iron-sulfur protein from potato mitochondria
Plant Mol. Biol. 25 (2), 271-281 (1994)
Medline: 94289650


Comment:
Oklahoma ID: NGO.2029

Other subunits in the complex are cytochrome B and cytochrome C1,
NG2030 and NG2031.



Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to ubiquinol--cytochrome c reductase iron-sulfur subunit sequences. Residues 1-193 are 55% similar to UCRI_CHRVI (gb|AAB86973).

Residues 1-193 are virtually identical to NMB2053 in N.meningitidis (gb|AAF42373).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0723
COG name: Rieske Fe-S protein
Functional Class:  C
The phylogenetic pattern of COG0723 is ----yq-C-Br-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001281 (Rieske iron-sulfur protein 2Fe-2S subunit) with a combined E-value of 1.7e-26.
    IPB001281A    60-78
    IPB001281B    116-131
    IPB001281C    150-171


ProDom Summary:  Protein Domain Search
Residues 32-95 are 48% similar to a (C REDUCTASE SUBUNIT PROTEIN) protein domain (PD003126) which is seen in UCRI_CHRVI.

Residues 111-175 are 78% similar to a (DIOXYGENASE SUBUNIT PROTEIN IRON-SULFUR OXIDOREDUCTASE) protein domain (PD000299) which is seen in UCRI_CHRVI.



Paralogs:  Local Blast Search


NG2029 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 72 to 183 (E-value = 7.4e-07) place NG2029 in the Rieske family which is described as Rieske [2Fe-2S] domain (PF00355)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
66
transmembrane  
13  
29
transmembrane  
117  
133

PDB Hit:
pdb|1BE3|1BE3-E CYTOCHROME BC1 COMPLEX FROM BOVINE 105.0 6e-24
pdb|1BCC|1BCC-E CYTOCHROME BC1 COMPLEX FROM CHICKEN 105.0 7e-24
pdb|1RIE|1RIE STRUCTURE OF A WATER SOLUBLE FRAGMENT OF THE 103.0 2e-23
pdb|1EZV|1EZV-E STRU

Gene Protein Sequence:
MDNQEINNGRRRFLTLATCGAGGVAALGVATPFVASFFPSEKAKASGAAV
EVDVSKIEAGQLLTAEWQGKPIWVLNRTDQQLKDLKGLNGELTDPNSDAE
QQPEYAKNETRSIKPNILVAIGICTHLGCSPTFRPDIAPADLGADWKGGF
FCPCHGSKFDLAGRVYKGVPAPTNLVVPPYKYLSDTTILVGED

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAATCAAGAAATCAACAACGGCCGCCGCCGTTTCCTGACACTTGC
GACCTGCGGCGCGGGCGGAGTGGCAGCATTGGGTGTGGCAACGCCGTTTG
TGGCCAGTTTTTTCCCTTCGGAAAAAGCCAAGGCCTCCGGTGCTGCCGTC
GAGGTGGATGTCAGTAAAATCGAAGCGGGTCAGCTGCTGACCGCCGAGTG
GCAAGGCAAACCGATTTGGGTGCTCAACCGTACAGATCAGCAGCTTAAAG
ACCTGAAAGGCCTGAACGGCGAACTTACCGATCCCAATTCCGATGCGGAA
CAGCAGCCGGAGTATGCTAAAAACGAGACCCGTTCGATTAAGCCGAACAT
CCTTGTCGCCATCGGTATCTGCACCCATTTGGGCTGCTCGCCCACCTTCC
GTCCCGACATTGCCCCCGCCGATTTGGGCGCAGACTGGAAGGGCGGCTTC
TTCTGCCCGTGCCACGGTTCGAAATTCGACTTGGCCGGCCGCGTATATAA
AGGTGTTCCTGCCCCGACCAACCTGGTTGTCCCGCCATATAAATACTTGA
GCGACACAACTATCTTGGTGGGCGAAGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy