Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1674 IGR1666 IGR1665 IGR1668 IGR1673 IGR1672 IGR1671 IGR1670 IGR1675 IGR1667 IGR1669 NG2026 metR, - NG2027 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 gpdA,gpsA, - NG2021 petB,qcrB, - NG2030 NG2032 NG2026 metR, - NG2027 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 gpdA,gpsA, - NG2021 petB,qcrB, - NG2030 NG2032 NG2026 metR, - NG2027 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 gpdA,gpsA, - NG2021 petB,qcrB, - NG2030 NG2032 NG2023
* Calculated from Protein Sequence

Gene ID: NG2028

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1998145

Gene Stop:
1998891

Gene Length:
747

Molecular Weight*:
27399

pI*:
6.20

Net Charge*:
-4.72

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.2028

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to hypothetical proteins. Residues 12-249 are 51% similar to a hypothetical in H.influenzae (gb|AAC21783).

Residues 1-249 are 96% similar to NMB2054 in N.meningitidis (gb|AAF42374).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0327
COG name: Uncharacterized ACR, YbgI/Acr family
Functional Class:  S
The phylogenetic pattern of COG0327 is amtky---ebrhuj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002678 (Domain of unknown function DUF34) with a combined E-value of 2.4e-52.
    IPB002678A    22-32
    IPB002678B    53-65
    IPB002678C    87-110
    IPB002678D    167-177
    IPB002678E    189-221


ProDom Summary:  Protein Domain Search
Residues 25-248 are 51% similar to a (PROTEIN CONSERVED NGG1-INTERACTING FACTOR ACR FAMILY) protein domain (PD003720) which is seen in YBGI_HAEIN.

Residues 22-126 are 44% similar to a (CONSERVED HYPOTHETICAL PROTEIN) protein domain (PD179982) which is seen in O83942_TREPA.



Paralogs:  Local Blast Search


NG2028 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 11 to 245 (E-value = 1.2e-100) place NG2028 in the NIF3 family which is described as NIF3 (NGG1p interacting factor 3) (PF01784)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MVLRRDFLAWCDETLQTASFKDYAPNGLQVEGREYIGKIVTSVTASRAAI
DFAVEQKADLLLVHHGMFWKSELPTVTGWKKERIAALLRHDINMAGYHLP
LDVHPILGNNAQLADRLGFATEKRFGEQNLLNSGSLKQAKTLGALAAHIE
TVLQRKPVAIGNPEREIRRVAWCTGGAQGFFQTAIDEGVDLYLTGEISEA
QYHLANETGTAFISAGHHATERYGVRALAESAAEVFGLEVCHFDENNPA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTTGCGCAGAGATTTTTTAGCCTGGTGCGACGAAACGTTGCAGAC
GGCATCGTTTAAAGATTACGCCCCCAATGGTTTGCAGGTTGAAGGGAGGG
AATATATCGGGAAAATCGTTACGTCGGTAACGGCAAGCAGGGCAGCGATT
GATTTTGCTGTGGAGCAGAAGGCAGATTTGCTTTTGGTGCATCACGGTAT
GTTCTGGAAAAGCGAGCTGCCGACCGTTACCGGTTGGAAAAAAGAACGGA
TTGCCGCACTGTTACGGCACGACATCAATATGGCAGGCTACCATCTGCCC
CTGGATGTGCATCCCATACTGGGCAACAATGCCCAACTCGCCGACAGATT
GGGTTTTGCGACAGAAAAACGGTTCGGCGAACAAAACCTGCTCAACTCGG
GCAGCCTGAAACAAGCCAAGACACTCGGCGCATTGGCGGCGCATATTGAA
ACAGTTTTGCAACGTAAGCCTGTCGCCATCGGCAATCCCGAACGCGAAAT
CCGACGGGTCGCATGGTGTACCGGCGGTGCACAGGGCTTTTTTCAGACGG
CAATAGATGAAGGCGTCGATCTGTATCTGACGGGTGAAATTTCCGAAGCC
CAATACCACCTCGCCAATGAAACGGGTACGGCTTTCATTTCGGCAGGGCA
TCACGCGACGGAACGTTACGGCGTACGCGCGCTGGCAGAATCGGCGGCAG
AGGTTTTCGGGTTGGAAGTGTGCCATTTTGACGAAAACAACCCGGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy