Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1674 IGR1666 IGR1665 IGR1668 IGR1673 IGR1664 IGR1672 IGR1671 IGR1670 IGR1675 IGR1667 IGR1669 NG2026 metR, - NG2027 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 gpdA,gpsA, - NG2021 petB,qcrB, - NG2030 NG2032 pepC,ppc, - NG2020 NG2026 metR, - NG2027 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 gpdA,gpsA, - NG2021 petB,qcrB, - NG2030 NG2032 pepC,ppc, - NG2020 NG2026 metR, - NG2027 NG2022 rpsI, - NG2025 rplM, - NG2024 petA, - NG2029 NG2028 petC, - NG2031 gpdA,gpsA, - NG2021 petB,qcrB, - NG2030 NG2032 pepC,ppc, - NG2020 NG2023
* Calculated from Protein Sequence

Gene ID: NG2027

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
metR  

Definition:
methionine biosynthesis transcriptional regulator (MetR)

Gene Start:
1998016

Gene Stop:
1997090

Gene Length:
927

Molecular Weight*:
34800

pI*:
5.80

Net Charge*:
-6.76

EC:
 

Functional Class:
Regulatory functions  

Pathway: pathway table

Secondary Evidence:
Maxon,M.E., Wigboldus,J., Brot,N. and Weissbach,H.
Structure-function studies on Escherichia coli MetR protein, a
putative prokaryotic leucine zipper protein. Proc. Natl. Acad. Sci. U.S.A. 87 (18), 7076-7079 (1990)
Medline: 90384950

Plamann,L.S. and Stauffer,G.V.
Nucleotide sequence of the Salmonella typhimurium metR gene and the metR-metE control region
J. Bacteriol. 169 (9), 3932-3937 (1987)
Medline: 87307964



Comment:
'met' genes include: NG2044, metG/metS; NG1149, metZ; NG0933, metX; NG0929, metF; NG0386, metC/metB2; NG0928, metE; and NG0106, metK, all involved in methionine biosynthesis.

Oklahoma ID: NGO.2027c

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to LysR/MetR family proteins. Residues 3-306 are 68% similar to METR_HAEIN (gb|AAC23383).

Residues 1-309 are virtually identical to NMA0381 in N.meningitidis (11278094|).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0583
COG name: Transcriptional regulators, LysR family
Functional Class:  K
The phylogenetic pattern of COG0583 is aMt--Q-CEBRH---------
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search
***** IPB000847 (Bacterial regulatory protein, LysR family) with a combined E-value of 9e-16.
    IPB000847    21-54
***** IPB001583 (NodD transcription activator carboxyl terminal region) with a combined E-value of 2.1e-08.
    IPB001583A    9-59


ProDom Summary:  Protein Domain Search
Residues 164-292 are 65% similar to a (TRANSCRIPTION REGULATION DNA-BINDING TRANSCRIPTIONAL) protein domain (PD003845) which is seen in METR_HAEIN.

Residues 96-152 are 82% similar to a (TRANSCRIPTIONAL ACTIVATOR PROTEIN METR) protein domain (PD187968) which is seen in METR_HAEIN.

Residues 5-76 are 75% similar to a (TRANSCRIPTION REGULATION DNA-BINDING PROTEIN) protein domain (PD000161) which is seen in METR_HAEIN.



Paralogs:  Local Blast Search


NG2027 is paralogously related to NG1578 (cysteine transcriptional regulatory protein, activator (CysB)) (7e-10), NG0692 (LysR family transcriptional regulator) (2e-08), NG1813 (LysR-family transcriptional regulator) (4e-07) and NG1706 (LysR-family transcriptional regulator) (3e-06).


Pfam Summary:  Pfam Search
Residues 7 to 66 (E-value = 2.4e-24) place NG2027 in the HTH_1 family which is described as Bacterial regulatory helix-turn-helix protein, lysR family (PF00126)
Residues 90 to 297 (E-value = 7.1e-39) place NG2027 in the LysR_substrate family which is described as LysR substrate binding domain (PF03466)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
53  
100

PDB Hit:
pdb|1AL3|1AL3 COFACTOR BINDING FRAGMENT OF CYSB FROM KLEBSIELLA 72.2 1e-13
pdb|1I69|1I69-A CRYSTAL STRUCTURE OF THE REDUCED FORM OF OXYR 46.6 6e-06
pdb|1I6A|1I6A-A CRYSTAL STUCTURE OF THE OXIDIZED FORM OF OXYR 45.0 2e-05
pdb|1AL3|1AL3 COFAC

Gene Protein Sequence:
MDSIIELRHLKTLLALEETGSVSLAAKRVFLTQSALSHQIRMLENHYGTP
LFERKSTPLRFTPVGERLLRLAHELIPQVAVAERDLARITEGEAGELRIA
VECHTCFDWLMPAMGEFRPMWPQVELDIVSGFQADPVGLLLQHRADLAIV
SEAEKQSSISFHPLFAYEMVGICAPDHPLAAKNVWTAEDFIGETLITYPV
PDEMLDLPKKILIPKNINPPRRHSELTIAIIQLVASRRGIAALPYWTVMP
YLEKGYVVHRQITADGLQSKLYAAIRTEDTDKSYLNNFCQIIRERGFADL
PGLSELEPV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTCCATTATCGAATTGCGCCACCTCAAAACCCTGCTGGCACTTGA
AGAAACCGGCAGCGTCTCCCTTGCCGCCAAACGGGTTTTCCTTACCCAAT
CCGCCCTTTCCCACCAGATCCGTATGCTCGAAAACCACTACGGCACGCCG
CTGTTCGAACGCAAATCCACGCCCCTGCGCTTTACCCCGGTGGGCGAAAG
GCTGCTGCGCCTCGCCCACGAACTGATACCTCAAGTTGCTGTTGCAGAAC
GAGATTTGGCGCGAATCACGGAAGGGGAGGCGGGAGAGCTGCGGATTGCC
GTCGAATGCCATACCTGTTTCGACTGGCTGATGCCCGCCATGGGCGAATT
CCGCCCGATGTGGCCCCAAGTCGAACTGGATATCGTATCAGGATTCCAAG
CGGATCCCGTCGGGCTGCTGCTGCAACACCGCGCCGACCTCGCCATTGTC
TCCGAAGCCGAAAAACAAAGCAGCATCAGCTTCCACCCACTGTTTGCCTA
CGAAATGGTCGGCATTTGCGCCCCGGACCATCCGCTTGCCGCCAAAAACG
TTTGGACGGCGGAAGACTTTATCGGGGAAACCCTGATTACCTATCCCGTT
CCCGACGAGATGCTGGATTTACCCAAAAAAATCCTGATTCCGAAAAACAT
CAACCCGCCGCGCCGGCACAGCGAGCTGACCATCGCCATTATCCAACTGG
TTGCCAGCAGACGTGGCATTGCCGCCCTTCCCTATTGGACAGTCATGCCC
TACCTTGAAAAAGGCTATGTCGTCCACCGCCAAATTACTGCCGACGGACT
GCAAAGCAAACTGTATGCCGCCATCCGCACTGAAGACACAGATAAAAGTT
ATCTGAACAACTTTTGCCAAATCATACGTGAACGCGGCTTCGCGGACTTG
CCCGGATTAAGTGAGTTGGAACCGGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy