Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1660 IGR1666 IGR1665 IGR1668 IGR1662 IGR1661 IGR1663 IGR1664 IGR1671 IGR1670 IGR1667 IGR1669 NG2026 thiF,moeB, - NG2019 metR, - NG2027 NG2018 slyX, - NG2017 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 NG2028 gpdA,gpsA, - NG2021 NG2016 pepC,ppc, - NG2020 NG2026 thiF,moeB, - NG2019 metR, - NG2027 NG2018 slyX, - NG2017 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 NG2028 gpdA,gpsA, - NG2021 NG2016 pepC,ppc, - NG2020 NG2026 thiF,moeB, - NG2019 metR, - NG2027 NG2022 rpsI, - NG2025 rplM, - NG2024 NG2028 gpdA,gpsA, - NG2021 NG2016 pepC,ppc, - NG2020 slyX, - NG2017 NG2023 NG2018
* Calculated from Protein Sequence

Gene ID: NG2021

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gpdA  gpsA  

Definition:
glycerol-3-phosphate dehydrogenase; sn-glycerol-3-phosphate dehydrogenase

Gene Start:
1993132

Gene Stop:
1994118

Gene Length:
987

Molecular Weight*:
35355

pI*:
6.40

Net Charge*:
-2.01

EC:
1.1.1.8  

Functional Class:
Central intermediary metabolism; Glycerol utilization  
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Schwan TG, Battisti JM, Porcella SF, Raffel SJ, Schrumpf ME, Fischer ER, Carroll JA, Stewart PE, Rosa P, Somerville GA.
Glycerol-3-Phosphate Acquisition in Spirochetes: Distribution and Biological Activity of Glycerophosphodiester Phosphodiesterase
(GlpQ) among Borrelia Species.
J Bacteriol. 2003 Feb;185(4):1346-56.
PMID: 12562805

Shimizu H, Nishiyama K, Tokuda H.
Expression of gpsA encoding biosynthetic sn-glycerol 3-phosphate dehydrogenase suppresses both the LB- phenotype of a secB null mutant and the cold-sensitive phenotype of a secG null mutant.
Mol Microbiol. 1997 Dec;26(5):1013-21.
PMID: 9426138

Rodionov DG, Ishiguro EE.
Dependence of peptidoglycan metabolism on phospholipid synthesis during growth of Escherichia coli.
Microbiology. 1996 Oct;142 ( Pt 10):2871-7.
PMID: 8885403

Comment:
Oklahoma ID: NGO.2021

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to G-3-P dehydrogenases. Residues 37-329 are 50% similar to the enzyme in Paucimonas lemoignei (gb|AAA65704).

Residues 1-329 are virtually identical to gb|AAF62339 in N.meningitidis.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0240
COG name: Glycerol 3-phosphate dehydrogenase
Functional Class:  C
The phylogenetic pattern of COG0240 is a-t-YqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001652 (NAD-dependent glycerol-3-phosphate dehydrogenase) with a combined E-value of 1.6e-46.
    IPB001652A    3-20
    IPB001652B    21-33
    IPB001652C    36-81
    IPB001652E    131-147
    IPB001652F    181-220
    IPB001652G    233-254
    IPB001652H    269-305


ProDom Summary:  Protein Domain Search
Residues 44-321 are 52% similar to a (DEHYDROGENASE GLYCEROL-3-PHOSPHATE) protein domain (PD001649) which is seen in Q59680_PSELE.



Paralogs:  Local Blast Search


NG2021 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 321 (E-value = 5.4e-113) place NG2021 in the NAD_Gly3P_dh family which is described as NAD-dependent glycerol-3-phosphate dehydrogenase (PF01210)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
179  
195

PDB Hit:
pdb|1EVY|1EVY-A CRYSTAL STRUCTURE OF LEISHMANIA MEXICANA 181.0 1e-46
pdb|1BG6|1BG6 CRYSTAL STRUCTURE OF THE 46.6 6e-06
pdb|1EVY|1EVY-A CRYSTAL STRUCTURE OF LEISHMANIA MEXICANA 489.0 0e+00
pdb|1BG6|1BG6 CRYST

Gene Protein Sequence:
MKITVIGAGSWGTALALHFSQHGNRVSLWTRNADQVRQMQEARENKRGLP
GFSFPETLEVCADLAEALKDSGLVLIVTSVAGLRSSAELLKQYGAGHLPV
LAACKGFEQDTGLLTFQVLKEVLPDNKKIGVLSGPSFAQELAKQLPCAVV
LASENQEWIEELVPQLNTTVMRLYGSTDVIGVAVGGSVKNVMAIATGLSD
GLEYGLNARAALVTRGLAEITRLASAMGAQPKTMMGLAGIGDLILTCTGA
LSRNRRVGLGLAEGKELHQVLVEIGHVSEGVSTIEEVFNTACKYQIDMPI
TQTLLQLIRKEMTPQQVVERLMERSARFE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTACCGTTATCGGCGCAGGTTCGTGGGGTACGGCGCTCGCCCT
GCATTTTTCCCAACACGGCAACCGCGTATCCCTGTGGACGCGCAACGCAG
ACCAAGTCCGCCAAATGCAGGAAGCGCGTGAAAACAAACGCGGACTGCCC
GGCTTTTCCTTTCCCGAAACCTTGGAAGTGTGTGCGGATTTGGCAGAGGC
GCTCAAAGACAGCGGACTTGTCCTTATCGTAACCTCCGTTGCCGGATTGA
GAAGCAGCGCAGAGCTGCTCAAACAGTACGGCGCGGGACACCTCCCCGTC
CTCGCCGCCTGCAAAGGCTTCGAGCAGGATACAGGGCTGCTGACCTTCCA
AGTCTTGAAAGAAGTATTGCCCGACAATAAGAAAATCGGCGTACTTTCCG
GTCCGAGTTTTGCACAGGAACTCGCCAAACAACTGCCCTGCGCCGTCGTC
CTCGCCTCCGAAAACCAAGAGTGGATTGAAGAACTCGTACCGCAGCTCAA
CACGACCGTCATGAGGCTTTACGGCAGTACCGACGTTATCGGCGTGGCAG
TAGGCGGTTCAGTCAAAAACGTCATGGCAATCGCTACCGGACTCTCCGAC
GGACTCGAATACGGACTCAACGCCCGTGCCGCACTGGTTACGCGCGGACT
GGCCGAAATCACCCGCCTTGCCTCCGCAATGGGCGCGCAGCCCAAAACCA
TGATGGGGCTTGCCGGCATCGGCGATCTCATCTTGACCTGTACCGGTGCA
CTTTCGCGCAACCGCCGCGTCGGCTTGGGTTTGGCAGAAGGCAAGGAACT
GCATCAGGTGCTGGTCGAAATCGGGCACGTTTCCGAAGGGGTCAGCACCA
TAGAAGAAGTCTTCAATACCGCCTGCAAATACCAAATCGATATGCCGATT
ACCCAAACCCTGCTGCAACTCATCCGCAAAGAAATGACCCCTCAGCAGGT
CGTCGAAAGGCTGATGGAACGCAGCGCGCGTTTCGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy