Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1660 IGR1666 IGR1665 IGR1668 IGR1659 IGR1662 IGR1661 IGR1663 IGR1664 IGR1667 IGR1669 NG2026 thiF,moeB, - NG2019 NG2018 slyX, - NG2017 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 hemK, - NG2015 gpdA,gpsA, - NG2021 NG2016 pepC,ppc, - NG2020 NG2026 thiF,moeB, - NG2019 NG2018 slyX, - NG2017 NG2023 NG2022 rpsI, - NG2025 rplM, - NG2024 hemK, - NG2015 gpdA,gpsA, - NG2021 NG2016 pepC,ppc, - NG2020 NG2026 thiF,moeB, - NG2019 slyX, - NG2017 NG2022 rpsI, - NG2025 rplM, - NG2024 hemK, - NG2015 gpdA,gpsA, - NG2021 NG2016 pepC,ppc, - NG2020 NG2018 NG2023
* Calculated from Protein Sequence

Gene ID: NG2020

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepC  ppc  

Definition:
phosphoenolpyruvate carboxylase

Gene Start:
1990256

Gene Stop:
1993006

Gene Length:
2751

Molecular Weight*:
103313

pI*:
7.40

Net Charge*:
3.55

EC:
4.1.1.31  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Carbon fixation
Pyruvate metabolism
Reductive carboxylate cycle (CO2 fixation)

Secondary Evidence:
Fujita N, Miwa T, Ishijima S, Izui K, Katsuki H.
The primary structure of phosphoenolpyruvate carboxylase of Escherichia coli. Nucleotide sequence of the ppc gene and deduced amino acid sequence.
J Biochem (Tokyo). 1984 Apr;95(4):909-16.
PMID: 6086598

Izui K, Miwa T, Kajitani M, Fujita N, Sabe H, Ishihama A, Katsuki H.
Promoter analysis of the phosphoenolpyruvate carboxylase gene of Escherichia coli.
Nucleic Acids Res. 1985 Jan;13(1):59-71.
PMID: 3889833

Sutton F, Butler ET, Smith TE.
Isolation of the structural gene encoding a mutant form of Escherichia coli phosphoenolpyruvate carboxylase deficient in regulation by fructose 1,6-bisphosphate. Identification of an amino acid substitution in the mutant.
J Biol Chem. 1986 Dec;261(34):16078-81.
PMID: 3536922

Terada K, Murata T, Izui K.
Site-directed mutagenesis of phosphoenolpyruvate carboxylase from E. coli: the role of His579 in the catalytic and regulatory functions.
J Biochem (Tokyo). 1991 Jan;109(1):49-54.
PMID: 2016273

Yano M, Terada K, Umiji K, Izui K.
Catalytic role of an arginine residue in the highly conserved and unique sequence of phosphoenolpyruvate carboxylase.
J Biochem (Tokyo). 1995 Jun;117(6):1196-200.
PMID: 7490260

Inoue M, Hayashi M, Sugimoto M, Harada S, Kai Y, Kasai N, Terada K, Izui K.
First crystallization of a phosphoenolpyruvate carboxylase from Escherichia coli.
J Mol Biol. 1989 Aug;208(3):509-10.
PMID: 2677392

Kai Y, Matsumura H, Inoue T, Terada K, Nagara Y, Yoshinaga T, Kihara A, Tsumura K, Izui K.
Three-dimensional structure of phosphoenolpyruvate carboxylase: a proposed mechanism for allosteric inhibition.
Proc Natl Acad Sci U S A. 1999 Feb;96(3):823-8.
PMID: 9927652

Comment:
Oklahoma ID: NGO.2020

For other 'pep' genes, see NG1227 (pepA, ampA), NG1456 (pepP), NG0158 (pepN, ampN).

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to Ppc proteins. Residues 22-917 are 39% similar to CAPP_RHOPA (D89668).

Residues 18-917 is 90% similar to NMB2061 in N.meningitidis (gb|AAF42380).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB001449 (Phosphoenolpyruvate carboxylase) with a combined E-value of 3.1e-273.
    IPB001449A    75-110
    IPB001449B    147-201
    IPB001449C    253-299
    IPB001449D    323-355
    IPB001449E    388-442
    IPB001449F    484-538
    IPB001449G    559-612
    IPB001449H    613-661
    IPB001449I    734-775
    IPB001449J    784-829
    IPB001449K    854-892
    IPB001449L    896-917


ProDom Summary:  Protein Domain Search
Residues 31-917 are 39% similar to a (CARBOXYLASE PHOSPHOENOLPYRUVATE LYASE CARBON DIOXIDE) protein domain (PD001820) which is seen in CAPP_RHOPA.



Paralogs:  Local Blast Search


NG2020 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 917 (E-value = 6e-84) place NG2020 in the PEPcase family which is described as Phosphoenolpyruvate carboxylase (PF00311)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
98
transmembrane  
510  
526
non-globular  
841  
917

PDB Hit:
pdb|1FIY|1FIY THREE-DIMENSIONAL STRUCTURE OF 360.0 0e+00
pdb|1JQO|1JQO-A CRYSTAL STRUCTURE OF C4-FORM PHOSPHOENOLPYRUVATE335.0 3e-92
pdb|1FIY|1FIY THREE-DIMENSIONAL STRUCTURE OF 1099.0 0.000000
pdb|1JQO|1JQO-A C

Gene Protein Sequence:
MRHLRYIYSIYGNERKIMQLHILNNPKDAALAADAEFLKQSLFNLLHEEA
SPLVVETVKLLSTSDDSAALIEKVLPQLDERQTYDLTLACGLFAQILNIA
EDVHHERRRQIHEDAGHNAAEGSLTETVRRLKAGKADGKSVQRQLDNTSV
TAVLTAHPTEVQRQTVLNFNRRIRALLPQRERCTNADALARLRREIDTVL
LGLWQTSETRRHKLSVNDEINNGVSIFPMSFFEALPKLYRKMEHDFQTAY
PDVRVPNILKIGGWIGGDRDGNPFVSGETLRFAFRRHADAVFRFYRSELD
KLYRELPLSIRRVKVNDDVMALAALSPDEEIARTEEPYRRAIAYIMARAM
GKARSLGLGMGCKFGFLEPYASAQKFLDDLKKLQRSLIDNGSRLLAEGRL
ADLIRSVSVFGFHMMPLDLRQHAGKHADVVAELFQHAGLEDYNSLNEEQK
QAALLRELGHQRPLYSPFITYSDHTRRELAIFNEARKIKDEFGEDAVTQS
IISNCEQPGDLLALALLLKESGLLAVENGKPHSRINIVPLFETIEALENA
CPVMETMFRLDWYDALLESRGNIQEIMLGYSDSNKDGGYVTSSWCLHQAE
LGLVELFKKYDVRMRLFHGRGGSVGRGGGPSYQAILAQPAGSVAGQIRIT
EQGEVITAKYADPGNAQRNLETLVAATLEASILPDKKDPDAKLMQALSDV
SFKYYRELITHPDFIDYFLQTSPIQEIATLNLGSRPASRKTLARIQDLRA
IPWVFSWMQNRLMLPAWYGFGSAVETLCEGSPETLAALRGHAQNNPFFQA
MLSNMEQVMAKTDITLAENYAGLSESPEKAKVIFGMIKEEYRRSRKALLD
LLQTEELLRDNRSLARSLALRIPYLNALNGLQVAMLKRLRKEPDNPHALL
MVHLTINGVAQGLRNTG

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGCATTTGAGGTACATTTACAGTATTTACGGCAATGAGAGGAAAAT
CATGCAACTGCATATCCTGAACAATCCGAAGGACGCGGCTTTGGCGGCGG
ACGCGGAATTTTTGAAACAGTCCCTGTTCAACCTCCTGCACGAAGAAGCC
TCGCCGTTGGTTGTCGAAACGGTCAAACTCTTGTCCACTTCCGACGACAG
CGCGGCATTGATTGAAAAAGTATTGCCGCAATTGGACGAACGGCAGACCT
ACGATCTGACGCTTGCCTGCGGGCTGTTCGCCCAGATTCTGAATATCGCC
GAAGACGTGCACCACGAACGCCGCCGCCAAATCCACGAAGATGCCGGCCA
CAACGCAGCAGAAGGCAGCCTGACGGAAACCGTCCGCAGGCTCAAAGCGG
GGAAAGCCGACGGCAAATCGGTGCAGCGGCAGTTGGACAATACGTCCGTT
ACCGCCGTTTTGACCGCGCACCCGACCGAAGTGCAACGCCAAACCGTTTT
GAATTTCAACCGCCGCATCCGCGCGCTGCTGCCGCAACGCGAACGCTGCA
CCAATGCCGACGCGCTGGCACGGCTGCGCCGCGAAATCGACACCGTGCTT
CTGGGCTTGTGGCAGACCAGCGAAACGCGCCGCCACAAACTCAGCGTCAA
CGACGAAATCAACAACGGCGTGTCCATCTTCCCGATGAGCTTTTTTGAAG
CCCTGCCCAAACTCTACCGCAAGATGGAACACGACTTTCAGACGGCCTAT
CCCGATGTCCGCGTTCCGAATATCCTTAAAATCGGCGGCTGGATCGGCGG
CGACCGCGACGGCAATCCGTTTGTTTCTGGCGAAACCCTGCGCTTTGCCT
TCCGCCGCCACGCCGATGCCGTGTTCCGTTTTTACCGCAGCGAACTCGAC
AAACTTTACCGCGAACTGCCGCTTTCCATCCGCCGCGTCAAAGTCAACGA
CGACGTAATGGCACTGGCAGCCCTCTCGCCTGACGAAGAAATCGCCCGCA
CCGAAGAACCTTACCGCCGCGCCATTGCCTACATTATGGCGCGCGCTATG
GGCAAAGCGCGCTCGCTCGGTTTGGGCATGGGCTGCAAATTCGGCTTTCT
CGAGCCTTATGCTTCGGCCCAAAAATTTCTCGATGATTTGAAAAAATTGC
AACGTTCCCTTATCGACAACGGCAGCCGCCTGCTTGCCGAAGGCCGTTTG
GCAGACCTCATCCGTTCCGTGTCCGTGTTCGGCTTCCACATGATGCCGCT
CGACCTGCGCCAACACGCAGGCAAACACGCCGATGTGGTTGCCGAGCTTT
TCCAACACGCAGGCTTGGAAGACTACAACAGCCTGAACGAAGAGCAAAAA
CAAGCCGCCTTGTTGCGCGAATTGGGCCACCAACGTCCGCTGTACAGCCC
GTTCATCACATACAGCGACCATACCCGCCGCGAATTGGCGATTTTCAACG
AAGCGCGCAAAATCAAAGACGAATTTGGCGAAGATGCCGTAACACAAAGC
ATTATTTCCAACTGCGAACAACCCGGCGACCTGCTCGCCTTGGCATTGCT
GCTGAAAGAAAGCGGCCTGTTGGCGGTGGAAAACGGCAAACCGCACAGCC
GCATCAACATCGTGCCTCTGTTTGAAACCATCGAAGCGCTCGAAAATGCC
TGTCCGGTCATGGAAACCATGTTCCGCCTCGACTGGTATGATGCCCTGCT
CGAAAGCCGCGGCAACATCCAAGAAATCATGCTCGGCTATTCCGACTCCA
ACAAAGACGGCGGCTACGTTACCAGCTCATGGTGTCTGCATCAGGCGGAA
TTGGGCTTGGTCGAACTCTTCAAAAAATACGATGTCCGCATGCGCTTGTT
CCACGGTCGAGGCGGCAGCGTCGGACGCGGCGGCGGCCCGTCTTACCAAG
CCATCTTGGCGCAACCCGCAGGCAGCGTTGCCGGACAAATCCGCATTACC
GAGCAAGGCGAAGTCATCACCGCCAAATACGCCGACCCCGGCAACGCCCA
ACGCAACTTGGAAACCTTGGTTGCCGCGACTTTGGAAGCCAGCATCCTGC
CGGATAAAAAAGACCCTGATGCCAAACTGATGCAGGCATTGTCGGACGTA
TCGTTCAAATACTACCGCGAACTGATTACCCACCCCGACTTCATCGACTA
CTTCCTGCAAACCAGCCCGATTCAGGAAATCGCCACCCTCAACCTCGGCA
GCCGTCCCGCCAGCCGCAAAACCCTGGCGCGAATTCAGGATTTACGCGCG
ATTCCGTGGGTATTCTCCTGGATGCAAAACCGCCTCATGCTGCCGGCTTG
GTACGGTTTCGGCAGCGCGGTGGAAACCTTGTGCGAAGGCAGCCCCGAAA
CCCTCGCCGCCCTGCGCGGACACGCCCAAAACAACCCCTTCTTCCAAGCG
ATGCTCTCCAATATGGAACAAGTGATGGCGAAAACCGACATCACCTTGGC
GGAAAACTACGCCGGTTTGAGCGAATCACCCGAAAAGGCAAAAGTCATCT
TCGGCATGATTAAGGAAGAATACCGACGCAGCCGCAAAGCCCTGCTCGAC
CTGCTGCAAACCGAAGAACTTTTGCGCGACAACCGCAGCCTCGCCCGTTC
GCTCGCTTTGAGGATTCCATACCTGAACGCGCTCAACGGTTTGCAAGTCG
CCATGCTCAAACGCCTGCGCAAAGAACCCGACAATCCGCACGCCCTGCTG
ATGGTGCACCTGACCATCAACGGCGTGGCGCAAGGTTTGCGCAATACCGG
C


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy