Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1660 IGR1656 IGR1659 IGR1662 IGR1661 IGR1663 IGR1657 IGR1655 IGR1658 thiF,moeB, - NG2019 NG2018 slyX, - NG2017 glnP, - NG2012 glnQ, - NG2013 cjaA,apaA, - NG2014 hemK, - NG2015 NG2016 tldD, - NG2010 pepC,ppc, - NG2020 thiF,moeB, - NG2019 NG2018 slyX, - NG2017 glnP, - NG2012 glnQ, - NG2013 cjaA,apaA, - NG2014 hemK, - NG2015 NG2016 tldD, - NG2010 pepC,ppc, - NG2020 thiF,moeB, - NG2019 slyX, - NG2017 glnP, - NG2012 glnQ, - NG2013 cjaA,apaA, - NG2014 hemK, - NG2015 NG2016 tldD, - NG2010 pepC,ppc, - NG2020 glnM,nocM, - NG2011 glnM,nocM, - NG2011 NG2018
* Calculated from Protein Sequence

Gene ID: NG2015

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemK  

Definition:
protoporphyrinogen oxidase (HemK)

Gene Start:
1986414

Gene Stop:
1987268

Gene Length:
855

Molecular Weight*:
31821

pI*:
6.30

Net Charge*:
-2.58

EC:
1.3.3.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table

Secondary Evidence:
Nakayashiki,T., Nishimura,K. and Inokuchi,H.
Cloning and sequencing of a previously unidentified gene that is
involved in the biosynthesis of heme in Escherichia coli.
Gene 153 (1), 67-70 (1995)
Medline: 95189105


Comment:
Oklahoma ID: NGO.2015

For other 'hem' genes, see NG0234 and NG1580 (hemN), NG0293 (hemH), NG0360 (hemX), NG0362 (hemE), NG0385 (hemB), NG1318 (hemA
O), NG1403 (hemA), NG0040 (hemL).

Blast Summary:  PSI-Blast Search
NG2015 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 2576396, a predicted protoporphyrinogen oxidase.

Several matches in gapped BLAST to HemK proteins. Residues 19-280 are 41% similar to the enzyme from E.coli (gb|AAG56070).

Residues 10-285 are 92% similar to residues 148-423 of NMB2065 in N.meningitidis (gb|AAF42384).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 185-279 are 48% similar to a (PROTEIN METHYLTRANSFERASE HEMK) protein domain (PD005237) which is seen in HEMK_ECOLI.

Residues 1-27 are identical to a (POSSIBLE PROTOPORPHYRINOGEN OXIDASE) protein domain (PD089793) which is seen in O34189_NEIGO.

Residues 137-218 are identical to a (POSSIBLE PROTOPORPHYRINOGEN OXIDASE) protein domain (PD089786) which is seen in O34189_NEIGO.

Residues 28-136 are 88% similar to a (PROTEIN METHYLTRANSFERASE TRANSFERASE HEMK HOMOLOG) protein domain (PD001640) which is seen in O34189_NEIGO.



Paralogs:  Local Blast Search


NG2015 is paralogously related to NG1300 (adenine specific methylase) (9e-16).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
199  
285

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MFKPHRRQTGRKMTFDEWLGLSKLPKIEARMLLQYVSEYTRVQLLTRGGE
EMPDEIRQRADRLAQRRLNGEPVAYILGVREFYGRRFTVNPNVLIPRPET
EHLVEAVLARLPENGRVWDLGTGSGAVAVTVALERPDAFVRASDISTPAL
ETARKNAADLGARVEFAHGSWFDTDMPSERQWDIIVSNPPYIENGDKHLS
QGDLRFEPQIALTDFSDGLSCIRTLAQGAPDRLAEGGFLLLEHGFDQGAA
VRGVLAENGFSGVEILPDLAGLDRVTLGKYMKHLK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAAGCCGCATCGGCGGCAGACGGGACGAAAAATGACGTTTGACGA
ATGGTTGGGCTTGTCAAAACTGCCTAAAATTGAAGCAAGGATGCTGCTGC
AATATGTTTCGGAATATACGCGCGTGCAGTTGTTGACGCGGGGCGGGGAA
GAAATGCCGGACGAAATCCGACAGCGGGCGGACAGGCTGGCGCAACGCCG
TCTGAACGGCGAGCCGGTTGCCTATATTTTAGGTGTGCGCGAATTTTATG
GCAGACGCTTTACAGTCAACCCGAACGTGCTGATTCCGCGCCCCGAAACC
GAACACTTGGTCGAAGCCGTATTGGCGCGCCTGCCCGAAAACGGGCGCGT
GTGGGATTTGGGGACGGGCAGCGGCGCAGTTGCCGTAACCGTTGCGCTCG
AACGCCCCGATGCGTTTGTGCGCGCATCCGACATCAGCACGCCCGCCCTT
GAAACGGCGCGGAAAAATGCGGCGGATTTGGGCGCGCGGGTCGAATTTGC
ACACGGTTCGTGGTTCGACACCGATATGCCGTCTGAAAGGCAATGGGACA
TCATCGTGTCCAACCCGCCCTATATCGAAAACGGCGATAAACATTTGTCG
CAAGGCGATTTGCGGTTTGAGCCGCAAATCGCGCTGACCGACTTTTCAGA
CGGCCTAAGCTGCATCCGAACCTTGGCGCAAGGCGCGCCCGACCGTTTGG
CGGAAGGCGGTTTTTTGTTGTTGGAACACGGTTTCGATCAGGGCGCGGCG
GTGCGCGGCGTGTTGGCGGAGAATGGTTTTTCGGGAGTGGAAATCCTGCC
GGATTTGGCCGGTTTGGACAGGGTTACGCTGGGGAAGTATATGAAGCATT
TGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy