Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1653 IGR1650 IGR1651 IGR1647 IGR1649 IGR1655 IGR1648 IGR1654 IGR1652 NG2003 NG2006 thiE, - NG2007 thiG, - NG2005 thiO, - NG2008 NG2009 NG2004 glnM,nocM, - NG2011 NG2002 tldD, - NG2010 bvg,birA, - NG2001 NG2003 NG2006 thiE, - NG2007 thiG, - NG2005 thiO, - NG2008 NG2009 NG2004 glnM,nocM, - NG2011 NG2002 tldD, - NG2010 bvg,birA, - NG2001 NG2003 NG2006 thiE, - NG2007 thiG, - NG2005 thiO, - NG2008 NG2009 NG2004 glnM,nocM, - NG2011 NG2002 tldD, - NG2010 bvg,birA, - NG2001
* Calculated from Protein Sequence

Gene ID: NG2007

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thiE  

Definition:
thiamin-phosphate pyrophosphorylase (ThiE)

Gene Start:
1978800

Gene Stop:
1978186

Gene Length:
615

Molecular Weight*:
21824

pI*:
7.50

Net Charge*:
1.06

EC:
2.5.1.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Thiamine  

Pathway: pathway table
Thiamine metabolism

Secondary Evidence:
Vander Horn,P.B., Backstrom,A.D., Stewart,V. and Begley,T.P.
Structural genes for thiamine biosynthetic enzymes (thiCEFGH) in
Escherichia coli K-12. J. Bacteriol. 175 (4), 982-992 (1993)
Medline: 93163063

Begley TP, Downs DM, Ealick SE, McLafferty FW, Van Loon AP, Taylor S, Campobasso N, Chiu HJ, Kinsland C, Reddick JJ, Xi J.
Thiamin biosynthesis in prokaryotes.
Arch Microbiol. 1999 Apr;171(5):293-300. Review.
PMID: 10382260


Comment:
Oklahoma ID: NGO.2007c

For other 'thi' genes, see NG1160 (thiD), NG1575 (thiL), NG2005 (thiG), NG2041 (thiC), NG2008 (thiO), NG2019 (thiF).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to ThiE proteins. Residues 3-191 are 45% similar to the enzyme in E.coli (AP002567).

Residues 1-205 is 88% similar to NMB2069 in N.meningitidis (gb|AAF42388).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0352
COG name: Thiamine monophosphate synthase
Functional Class:  H
The phylogenetic pattern of COG0352 is a--kyQ-ceBrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003733 (Thiamine monophosphate synthase (TMP)) with a combined E-value of 9.8e-46.
    IPB003733A    22-39
    IPB003733B    55-88
    IPB003733C    121-134
    IPB003733D    157-186


ProDom Summary:  Protein Domain Search
Residues 62-191 are 52% similar to a (PYROPHOSPHORYLASE THIAMINE LYASE SYNTHASE TMP PROTEIN) protein domain (PD149806) which is seen in THIE_ECOLI.



Paralogs:  Local Blast Search


NG2007 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 203 (E-value = 3.9e-45) place NG2007 in the TMP-TENI family which is described as Thiamine monophosphate synthase/TENI (PF02581)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
137  
205

PDB Hit:
pdb|2TPS|2TPS-A 82.3 6e-17
pdb|1G6C|1G6C-A 81.1 1e-16
pdb|1G69|1G69-A THIAMIN PHOSPHATE SYNTHASE 81.1 1e-16
pdb|1G4S|1G4S-A 81.1 1e-16
pdb|1G67|1G67-A THIAMIN PHOSPHATE SYNTHASE 81.1 1e-16
pdb|2TPS|

Gene Protein Sequence:
MTFPPLKSLLKFYAVVPTADWVGRMVKAGADTVQLRCKTLHGNELKREIA
RCVAACQGSRTQLFINDHWREAIEAGAYGVHLGQEDMDTADLAAIAAAGL
RLGLSTHSVAELDRALFVHPGYIASGAIFQTTTKQMPTAPQGLDKLREYV
EQARGTPVVAIGGIDLNNARAVLATGVSSLAAVRAVTEAANPEAVVKAFQ
ALWDG

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCTTCCCGCCCCTAAAATCCCTACTTAAATTCTACGCCGTCGTTCC
CACCGCCGATTGGGTGGGGCGCATGGTCAAAGCAGGTGCCGACACGGTGC
AACTGCGCTGTAAAACCTTGCACGGCAACGAATTGAAACGCGAAATCGCC
CGCTGCGTCGCCGCCTGTCAAGGCAGCCGCACACAGCTTTTCATCAACGA
CCACTGGCGCGAGGCAATCGAAGCGGGCGCATACGGCGTACATCTCGGGC
AGGAAGACATGGACACCGCCGACCTTGCCGCCATCGCCGCCGCCGGTTTG
CGTTTGGGTTTGAGTACGCACTCCGTCGCCGAACTCGACCGCGCCCTGTT
CGTACACCCCGGCTACATCGCCAGCGGCGCGATTTTCCAGACCACGACCA
AACAAATGCCCACCGCCCCGCAAGGCTTGGACAAATTGCGCGAATATGTG
GAACAGGCTCGCGGCACGCCCGTCGTCGCCATCGGCGGCATCGATTTGAA
CAACGCCCGAGCCGTGCTGGCCACCGGCGTTTCCTCACTCGCCGCCGTCC
GCGCCGTAACCGAAGCGGCAAATCCCGAAGCGGTGGTTAAAGCGTTTCAG
GCTTTGTGGGATGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy