Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Arg-5 tRNA-Pro-3 IGR1653 IGR1650 IGR1645 IGR1651 IGR1643 IGR1647 IGR1649 IGR1644 IGR1648 IGR1652 IGR1646 NG2003 NG2006 thiE, - NG2007 thiG, - NG2005 folD, - NG1999 thiO, - NG2008 asd, - NG1997 NG2004 NG2000 NG1996 NG1998 NG2002 bvg,birA, - NG2001 NG2003 NG2006 thiE, - NG2007 thiG, - NG2005 folD, - NG1999 thiO, - NG2008 asd, - NG1997 NG2004 NG2000 NG1996 NG1998 NG2002 bvg,birA, - NG2001 NG2003 NG2006 thiE, - NG2007 thiG, - NG2005 folD, - NG1999 thiO, - NG2008 asd, - NG1997 NG2004 NG2000 NG1996 NG1998 NG2002 bvg,birA, - NG2001
* Calculated from Protein Sequence

Gene ID: NG2001

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bvg  birA  

Definition:
BirA protein/Bvg accessory factor

Gene Start:
1973252

Gene Stop:
1975027

Gene Length:
1776

Molecular Weight*:
64158

pI*:
7.50

Net Charge*:
3.86

EC:
6.3.4.15  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Howard,P.K., Shaw,J. and Otsuka,A.J.
Nucleotide sequence of the birA gene encoding the biotin operon
repressor and biotin holoenzyme synthetase functions of Escherichia coli. Gene 35 (3), 321-331 (1985)
Medline: 86006282

Buoncristiani,M.R., Howard,P.K. and Otsuka,A.J.
DNA-binding and enzymatic domains of the bifunctional biotin operon repressor (BirA) of Escherichia coli. Gene 44 (2-3), 255-261 (1986)
Medline: 87055242


Comment:
Oklahoma ID: NGO.2001

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to BirA protein/Bvg accessory factor sequences. Residues 92-324 are 28% similar to the biotin protein ligase in Bordetella pertussis (gb|AAC68833).

Residues 1-591 is 89% similar to NMB2075 in N.meningitidis (gb|AAF42394).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0340
COG name: Biotin-(acetyl-CoA carboxylase) ligase
Functional Class:  H
The phylogenetic pattern of COG0340 is amtkyqvcebrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003142 (Biotin protein ligase C terminal domain) with a combined E-value of 8.3e-13.
    IPB003142A    118-134
    IPB003142B    176-185


ProDom Summary:  Protein Domain Search
Residues 92-323 are 29% similar to a (LIGASE BIOTIN BIRA PROTEIN) protein domain (PD004125) which is seen in Q9ZIU6_BORPE.

Residues 419-494 are 41% similar to a (PROTEIN CONSERVED BVG ACCESSORY) protein domain (PD013593) which is seen in BAF_BORPE.



Paralogs:  Local Blast Search


NG2001 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 86 to 219 (E-value = 3.2e-22) place NG2001 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)
Residues 276 to 323 (E-value = 4.8e-09) place NG2001 in the BPL_C family which is described as Biotin protein ligase C terminal domain (PF02237)
Residues 340 to 530 (E-value = 1.1e-19) place NG2001 in the Bvg_acc_factor family which is described as Bordetella pertussis Bvg accessory factor family (PF03309)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
155  
346
transmembrane  
450  
466

PDB Hit:
pdb|1BIA|1BIA BIRA BIFUNCTIONAL PROTEIN (ACTS AS BIOTIN OPERON 91.3 4e-19

Gene Protein Sequence:
MTVLKPSHWRVLAELADGLPQHVSQLAREADMKPQQLNGFWQQMPAHIRG
LLRQHDGYWRLVRPLAVFDAEGLRDLGERSGFQTALKHECASSNDEILEL
ARIAPDKAHKTICVTHLQSKGRGRQGRKWSHRLGECLMFSFGWAFDRPQY
ELGSLSPVAALACRRALGCLGLETQIKWPNDLVVGRDKLGGILIETVRAG
GKTVAVVGIGINFVLPKEVENAASVQSLFQTASRRGNADAAVLLETLLAE
LGAVLEQYAEEGFAPFLNEYETANRDHGKAVLLLRDGETVCEGTVKGVDG
RGVLHLETAEGEQTVVSGEISLRPDNRSVSVPKRPDSERFLLLEGGNSRL
KWAWVENGTFATVGSAPYRDLSPLGAEWAEKADGNVRIVGCAVCGESKKA
QVKEQLARKIEWLPSSAQALGIRNHYRHPEEHGSDRWFNALGSRRFSRNA
CVVVSCGTAVTVDALTDDGHYLGGTIMPGFHLMKESLAVRTANLNRPAGK
RYPFPTTTGNAVASGMMDAVCGSIMMMHGRLKEKNGAGKPVDVIITGGGA
AKVAEALPPAFLAENTVRVADNLVIHGLLNLIAAEGGESEHA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGGTTTTGAAGCCTTCGCATTGGCGGGTGTTGGCGGAGCTTGCCGA
CGGTTTGCCGCAACACGTATCGCAATTGGCGCGTGAGGCGGACATGAAGC
CGCAGCAGCTCAACGGTTTTTGGCAGCAGATGCCGGCGCATATACGCGGG
CTGTTGCGCCAACACGACGGCTATTGGCGGCTGGTGCGCCCCTTGGCGGT
TTTCGATGCCGAAGGTTTGCGCGATCTGGGGGAAAGGTCGGGTTTTCAGA
CGGCATTGAAGCACGAGTGCGCGTCCAGCAACGACGAGATACTGGAATTG
GCGCGGATTGCGCCGGACAAGGCGCACAAAACCATATGCGTGACCCACCT
GCAAAGTAAGGGCAGGGGGCGGCAGGGGCGGAAGTGGTCGCACCGTTTGG
GCGAGTGCCTGATGTTCAGTTTCGGCTGGGCGTTTGACCGGCCGCAGTAT
GAGTTGGGTTCGCTGTCGCCTGTTGCGGCACTTGCGTGCCGGCGCGCTTT
GGGGTGTTTGGGTTTGGAAACGCAAATCAAGTGGCCAAACGATTTGGTCG
TCGGACGCGACAAATTGGGCGGCATTCTGATTGAAACAGTCAGGGCGGGC
GGTAAAACGGTTGCCGTGGTCGGTATCGGCATCAATTTCGTGCTGCCCAA
GGAAGTGGAAAACGCCGCTTCCGTGCAGTCGCTGTTTCAGACGGCATCGC
GGCGGGGCAATGCCGATGCCGCCGTATTGCTGGAAACATTGCTTGCGGAA
CTGGGCGCGGTGTTGGAACAATATGCGGAAGAAGGGTTCGCGCCATTTTT
AAATGAGTATGAAACGGCCAACCGCGACCACGGCAAGGCGGTATTGCTGT
TGCGCGACGGCGAAACCGTGTGCGAAGGCACGGTTAAAGGCGTGGACGGA
CGAGGCGTTCTGCACTTGGAAACGGCAGAAGGCGAACAGACGGTCGTCAG
CGGCGAAATCAGCCTGCGGCCCGACAACAGGTCGGTTTCCGTGCCGAAGC
GGCCGGATTCGGAACGTTTTTTGCTGTTGGAAGGCGGGAACAGCCGGCTC
AAGTGGGCGTGGGTGGAAAACGGCACGTTCGCAACCGTGGGCAGCGCGCC
GTACCGCGATTTGTCGCCTTTGGGCGCGGAGTGGGCGGAAAAGGCGGATG
GAAATGTCCGCATCGTCGGTTGCGCCGTGTGCGGAGAATCCAAAAAGGCA
CAAGTGAAGGAACAGCTCGCCCGAAAAATCGAGTGGCTGCCGTCTTCCGC
ACAGGCTTTGGGCATACGCAACCACTACCGCCACCCCGAAGAACACGGTT
CCGACCGTTGGTTCAACGCCTTGGGCAGCCGCCGCTTCAGCCGCAACGCC
TGCGTCGTCGTCAGTTGCGGCACGGCGGTAACGGTTGACGCGCTCACCGA
TGACGGACATTATCTCGGCGGAACCATCATGCCCGGCTTCCACCTGATGA
AAGAATCGCTCGCCGTCCGAACCGCCAACCTCAACCGCCCCGCCGGCAAA
CGTTACCCTTTCCCGACCACAACGGGCAACGCCGTCGCAAGCGGCATGAT
GGACGCGGTTTGCGGCTCGATAATGATGATGCACGGCCGTTTGAAAGAAA
AAAACGGCGCGGGCAAGCCTGTCGATGTCATCATTACCGGCGGCGGCGCG
GCGAAAGTCGCCGAAGCCCTGCCGCCTGCATTTTTGGCGGAAAATACCGT
GCGCGTGGCGGACAACCTCGTCATCCACGGGCTGCTGAACCTGATTGCCG
CCGAAGGCGGGGAATCGGAACACGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy