Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Arg-5 tRNA-Pro-3 IGR1642 IGR1650 IGR1645 IGR1643 IGR1647 IGR1649 IGR1641 IGR1644 IGR1648 IGR1646 NG2003 folD, - NG1999 asd, - NG1997 NG2004 NG2000 NG1996 NG1998 exoA, - NG1994 NG2002 cysS, - NG1993 bvg,birA, - NG2001 NG2003 folD, - NG1999 asd, - NG1997 NG2004 NG2000 NG1996 NG1998 exoA, - NG1994 NG2002 cysS, - NG1993 bvg,birA, - NG2001 NG2003 folD, - NG1999 asd, - NG1997 NG2004 NG2000 NG1998 exoA, - NG1994 NG2002 cysS, - NG1993 bvg,birA, - NG2001 NG1995 NG1996 NG1995
* Calculated from Protein Sequence

Gene ID: NG1999

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
folD  

Definition:
methylenetetrahydrofolate dehydrogenase/cyclohydrolase (FolD)

Gene Start:
1972109

Gene Stop:
1971258

Gene Length:
852

Molecular Weight*:
29987

pI*:
5.70

Net Charge*:
-5.59

EC:
1.5.1.5  3.5.4.9  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate

Secondary Evidence:
Pawelek,P.D. and MacKenzie,R.E.
Methylenetetrahydrofolate dehydrogenase-cyclohydrolase from
Photobacterium phosphoreum shares properties with a mammalian
mitochondrial homologue
Biochim. Biophys. Acta 1296 (1), 47-54 (1996)
Medline: 96350419

D'Ari,L. and Rabinowitz,J.C.
Purification, characterization, cloning, and amino acid sequence of the bifunctional enzyme 5,10-methylenetetrahydrofolate
dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase from
Escherichia coli.
J. Biol. Chem. 266 (35), 23953-23958 (1991)
Medline: 92084696





Comment:
Oklahoma ID: NGO.1999c

For other 'fol' genes, see NG0267 (folI), NG0323 (folK), NG0857 (folB), NG1342 (folP), NG1694 (folA), NG0266 (folC).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to 5,10-methylene-tetrahydrofolate dehydrogenase sequences. Residues 1-283 are 64% similar to the bifunctional enzyme from P.aeruginosa (gb|AAG05185).

Residues 1-284 are virtually identical to NMA0354 in N.meningitidis (AL162752).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0190
COG name: 5,10-methylene-tetrahydrofolate dehydrogenase
Functional Class:  H
The phylogenetic pattern of COG0190 is ----Yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000672 (Tetrahydrofolate dehydrogenase/cyclohydrolase) with a combined E-value of 6e-132.
    IPB000672A    34-63
    IPB000672B    70-121
    IPB000672C    149-196
    IPB000672D    203-233
    IPB000672E    239-275


ProDom Summary:  Protein Domain Search
Residues 17-278 are 62% similar to a (METHYLENETETRAHYDROFOLATE DEHYDROGENASE CYCLOHYDROLASE) protein domain (PD002300) which is seen in FOLD_PHOPO.



Paralogs:  Local Blast Search


NG1999 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 121 (E-value = 1.4e-57) place NG1999 in the THF_DHG_CYH family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763)
Residues 123 to 283 (E-value = 4.2e-95) place NG1999 in the THF_DHG_CYH_C family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
35  
51
non-globular  
157  
254
transmembrane  
200  
216

PDB Hit:
pdb|1B0A|1B0A-A 5,10, METHYLENE-TETRAHYDROPHOLATE 341.0 1e-94
pdb|1DIA|1DIA-A HUMAN METHYLENETETRAHYDROFOLATE DEHYDROGENASE / 229.0 3e-61
pdb|1A4I|1A4I-A HUMAN TETRAHYDROFOLATE DEHYDROGENASE / 229.0 3e-61
pdb|1EDZ|1EDZ-A STRU

Gene Protein Sequence:
MSAQLINGKEVSQKHLQAIAEAVAQRQQDNLHTPCLAVVLVGGDPAGAVY
VRNKKTACQKCGIKSLSYELPESTSQEELLALVDRLNADSEVDGILVQLP
LPKHLDSQAILERISPDKDVDGFHPYNVGRLAVKMPLMRPCTPKGVMTLL
EAYGIDPKGKKAVVVGASNIVGRPQALELLLARATVTVCHSATENLADEV
AAADILVVGVGIPNFVKGGWIKPGAVVIDVGINRLDDGSLCGDVEFETAK
ERAAMITPVPGGVGPMTIATLMENTLHAASLHDA

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGGCACAACTGATCAACGGTAAAGAAGTTTCGCAAAAACACCTGCA
GGCGATTGCCGAAGCGGTGGCGCAACGCCAACAGGACAATCTGCACACGC
CTTGCCTGGCCGTGGTTTTGGTCGGAGGCGACCCTGCCGGCGCAGTTTAT
GTCCGCAACAAGAAAACCGCCTGCCAAAAATGCGGCATCAAGTCGCTGTC
GTACGAACTGCCCGAATCAACATCGCAGGAAGAACTGCTGGCATTGGTCG
ACCGTCTGAATGCCGATTCCGAAGTGGACGGTATTCTGGTTCAGCTTCCA
CTGCCGAAGCACCTCGACAGCCAAGCGATCTTGGAACGTATTTCGCCGGA
TAAGGACGTGGACGGCTTCCATCCTTACAATGTCGGCAGGCTGGCGGTCA
AAATGCCGCTGATGCGCCCGTGTACGCCCAAGGGCGTGATGACGCTTTTG
GAGGCTTACGGCATTGATCCGAAGGGGAAAAAAGCGGTCGTGGTCGGCGC
GTCGAATATTGTCGGCCGCCCGCAGGCGTTGGAATTGCTGCTGGCGCGCG
CAACGGTAACGGTCTGCCACAGTGCGACCGAAAATCTTGCCGATGAAGTT
GCCGCCGCCGATATTTTGGTGGTCGGCGTGGGCATTCCGAACTTTGTCAA
AGGCGGGTGGATCAAACCCGGCGCGGTCGTTATCGATGTGGGCATCAACC
GTTTGGACGACGGCAGCCTGTGCGGCGACGTGGAATTTGAAACGGCAAAA
GAACGGGCGGCGATGATTACGCCCGTTCCCGGCGGCGTGGGTCCGATGAC
GATTGCCACATTAATGGAAAACACTTTGCACGCAGCTTCGCTGCACGATG
CT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy