Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Arg-5 tRNA-Pro-3 IGR1642 IGR1640 IGR1639 IGR1645 IGR1643 IGR1641 IGR1644 IGR1646 folD, - NG1999 asd, - NG1997 NG2000 NG1996 NG1998 exoA, - NG1994 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 folD, - NG1999 asd, - NG1997 NG2000 NG1996 NG1998 exoA, - NG1994 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 folD, - NG1999 asd, - NG1997 NG2000 NG1998 exoA, - NG1994 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 NG1995 NG1996 NG1995
* Calculated from Protein Sequence

Gene ID: NG1994

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
exoA  

Definition:
exodeoxyribonuclease III

Gene Start:
1967579

Gene Stop:
1968355

Gene Length:
777

Molecular Weight*:
29614

pI*:
6.60

Net Charge*:
-1.49

EC:
3.1.11.2  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Shida T, Ogawa T, Ogasawara N, Sekiguchi J.
Characterization of Bacillus subtilis ExoA protein: a multifunctional DNA-repair enzyme similar to the Escherichia coli exonuclease III.
Biosci Biotechnol Biochem. 1999 Sep;63(9):1528-34.
PMID: 10540738

Puyet A, Greenberg B, Lacks SA.
The exoA gene of Streptococcus pneumoniae and its product, a DNA exonuclease with apurinic endonuclease activity.
J Bacteriol. 1989 May;171(5):2278-86.
PMID: 2468646

Comment:
Oklahoma ID: NGO.1994

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to exodeoxyribonuclease sequences. Residues 1-255 are 49% similar to an enzyme from Streptomyces coelicolor (AL132674).

Residues 1-259 are virtually identical to NMB2082 in N.meningitidis (gb|AAF42400).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0708
COG name: Exonuclease III
Functional Class:  L
The phylogenetic pattern of COG0708 is a-t-y--cebrhuj--ol--X
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000097 (AP endonucleases family 1) with a combined E-value of 7.2e-71.
    IPB000097A    2-14
    IPB000097B    29-38
    IPB000097C    63-100
    IPB000097D    142-176
    IPB000097E    202-249


ProDom Summary:  Protein Domain Search
Residues 2-253 are 41% similar to a (PROTEIN ENDONUCLEASE EXODEOXYRIBONUCLEASE) protein domain (PD002469) which is seen in O26314_METTH.



Paralogs:  Local Blast Search


NG1994 is paralogously related to NG1561 (exodeoxyribonuclease III) (6e-23).


Pfam Summary:  Pfam Search
Residues 2 to 254 (E-value = 2.4e-47) place NG1994 in the Exo_endo_phos family which is described as Endonuclease/Exonuclease/phosphatase family (PF03372)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1E9N|1E9N-A A SECOND DIVALENT METAL ION IN THE ACTIVE SITE 181.0 1e-46
pdb|1DE8|1DE8-B HUMAN APURINIC/APYRIMIDINIC ENDONUCLEASE-1 181.0 1e-46
pdb|1BIX|1BIX THE CRYSTAL STRUCTURE OF THE HUMAN DNA REPAIR 181.0 1e-46
pdb|1DEW|1DEW-A CRYS

Gene Protein Sequence:
MLKIISANVNGIRSAYKKGFYEYIAASGADIVCVQELKAQEADLSADMKN
PHGMHGYWHCAEKRGYSGVAVYSKRKPDNVQIGMGIEEFDREGRFVRCDF
GRLGVISLYLPSGSSAEERQQVKYRFLDAFYPMLEAMKNEGRDIVVCGDW
NIAHQNIDLKNWKGNQKNSGFLPEEREWIGKVIHTLGWTDMWRTLYPDVP
GYTWWSNRGQAYAKDVGWRIDYQMVTPELAAKAVSAHVYKDEKFSDHAPL
VVEYDYAAE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAAAATCATTTCCGCCAACGTCAACGGCATCCGCTCCGCCTACAA
AAAAGGTTTTTACGAATACATCGCCGCATCGGGCGCAGACATTGTCTGCG
TGCAGGAACTCAAAGCGCAGGAGGCTGATTTGTCTGCCGATATGAAAAAT
CCGCACGGGATGCACGGCTATTGGCATTGCGCCGAGAAGCGCGGTTACAG
CGGTGTGGCGGTGTACAGCAAACGCAAACCCGACAATGTGCAAATCGGCA
TGGGCATTGAGGAATTCGACCGCGAAGGGCGGTTTGTGCGTTGCGATTTC
GGCAGGTTGGGCGTCATTTCGCTTTATTTGCCCAGCGGCAGCAGCGCGGA
AGAACGCCAGCAGGTGAAATACCGTTTCCTCGATGCGTTTTACCCTATGC
TCGAAGCGATGAAAAACGAAGGGCGCGACATCGTCGTCTGCGGCGACTGG
AACATCGCCCACCAAAACATCGACCTGAAAAATTGGAAAGGCAATCAGAA
AAATTCGGGCTTCCTGCCCGAAGAGCGCGAGTGGATAGGCAAAGTCATCC
ATACGCTGGGCTGGACGGACATGTGGCGCACGCTCTATCCCGATGTGCCG
GGTTATACATGGTGGAGCAACCGCGGGCAGGCGTATGCGAAAGATGTCGG
GTGGCGCATCGATTATCAGATGGTTACGCCCGAACTTGCCGCCAAAGCCG
TGTCCGCACACGTTTATAAAGATGAAAAATTCTCGGATCACGCCCCTTTA
GTTGTGGAGTATGACTATGCTGCCGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy