Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1638 IGR1642 IGR1640 IGR1637 IGR1639 IGR1645 IGR1643 IGR1641 IGR1644 folD, - NG1999 asd, - NG1997 NG1996 NG1998 exoA, - NG1994 NG1989 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 folD, - NG1999 asd, - NG1997 NG1996 NG1998 exoA, - NG1994 NG1989 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 folD, - NG1999 asd, - NG1997 NG1998 exoA, - NG1994 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 NG1995 NG1996 NG1989 NG1995
* Calculated from Protein Sequence

Gene ID: NG1993

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cysS  

Definition:
cysteinyl-tRNA synthetase

Gene Start:
1965987

Gene Stop:
1967405

Gene Length:
1419

Molecular Weight*:
52794

pI*:
5.50

Net Charge*:
-14.91

EC:
6.1.1.16  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Cysteine metabolism

Secondary Evidence:
Eriani,G., Dirheimer,G. and Gangloff,J.
Cysteinyl-tRNA synthetase: determination of the last E. coli
aminoacyl-tRNA synthetase primary structure
Nucleic Acids Res. 19 (2), 265-269 (1991)
Medline: 91195046

Hou,Y.M., Shiba,K., Mottes,C. and Schimmel,P.
Sequence determination and modeling of structural motifs for the
smallest monomeric aminoacyl-tRNA synthetase
Proc. Natl. Acad. Sci. U.S.A. 88 (3), 976-980 (1991)
Medline: 91126117

Avalos,J., Corrochano,L.M. and Brenner,S.
Cysteinyl-tRNA synthetase is a direct descendant of the first
aminoacyl-tRNA synthetase
FEBS Lett. 286 (1-2), 176-180 (1991)
Medline: 91323511




Comment:
Oklahoma ID: NGO.1993

For other 'cys' genes, see NG0445 (cysA), NG1434 (cysA), NG1578 (cysB).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to cys-tRNA synthetases. Residues 1-471 are 57% similar to the enzyme in P.aeruginosa (gb|AAG05184).

Residues 1-473 are virtually identical to NMA0347 in N.meningitidis (11353109|).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0215
COG name: Cysteinyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0215 is a--kyqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 1.2e-08.
    IPB001412A    30-40
    IPB001412B    279-289


ProDom Summary:  Protein Domain Search
Residues 408-472 are 52% similar to a (SYNTHETASE CYSTEINYL-TRNA AMINOACYL-TRNA) protein domain (PD006340) which is seen in SYC_ECOLI.

Residues 269-402 are 52% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000476) which is seen in SYC_HAEIN.

Residues 115-245 are 63% similar to a (SYNTHETASE CYSTEINYL-TRNA AMINOACYL-TRNA) protein domain (PD186140) which is seen in O82267_ARATH.

Residues 4-109 are 65% similar to a (SYNTHETASE CYSTEINYL-TRNA AMINOACYL-TRNA) protein domain (PD118283) which is seen in SYC_HAEIN.



Paralogs:  Local Blast Search


NG1993 is paralogously related to NG2044 (methionyl-tRNA synthetase (MetG)) (3e-05) and NG0006 (leucyl-tRNA synthetase) (0.001).


Pfam Summary:  Pfam Search
Residues 14 to 330 (E-value = 1.8e-182) place NG1993 in the tRNA-synt_1e family which is described as tRNA synthetases class I (C) catalytic domain (PF01406)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
390  
406
coil-coil  
428  
463

PDB Hit:
pdb|1LI5|1LI5-A CRYSTAL STRUCTURE OF CYSTEINYL-TRNA SYNTHETASE 505.0 0e+00
pdb|1A8H|1A8H METHIONYL-TRNA SYNTHETASE FROM THERMUS 42.2 2e-04
pdb|1FFY|1FFY-A INSIGHTS INTO EDITING FROM AN ILE-TRNA 42.2 2e-04
pdb|1LI5|1LI5-A CRYS

Gene Protein Sequence:
MTAIYNTLTRQKEPFAPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMI
ARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGELNARFIQAMHEDA
DALGVLRPDIEPKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFA
AYGQLSGKSLDDLRAGERVEVDGFKRDPLDFVLWKAAKAGEPAWESPWGN
GRPGWHIECSAMSENLFGDTFDIHGGGADLQFPHHENEIAQSVGASGHTC
GHDHAQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQY
DPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTRLYTTLKNTPAAEFDLS
ENANGYTRRFYAAMNDDFGTVEAVAVLFELAGEVNKTNDAHLAGCLKALG
GIIGLLQRNPIEFLQGGAVSDGLSNEEIEDLIARRKQARADKNWAESDRI
RDLLNEHKIILEDSAGGTTWRRG

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGCCATCTACAACACCCTTACCCGTCAAAAAGAACCCTTCGCCCC
CATCGACCCTGAAAACGTGCGTATGTACGTCTGCGGCATGACCGTTTACG
ACTATTGCCACTTAGGCCATGCCCGTGTGATGGTGGTGTTCGACATGATT
GCCCGCTGGTTGCGCGAGTGCGGTTATCCGCTCACTTATGTGCGCAACAT
CACCGACATCGACGACAAAATCATCGCCCGTGCGGCTGAAAACGGCGAAA
CCATCGGCGAACTGAACGCGCGTTTCATTCAGGCGATGCACGAAGATGCC
GATGCTTTGGGCGTGTTGCGTCCCGACATCGAGCCGAAGGCGACGGAAAA
CATCCCGCAAATGATTGCCATGATTGAGACCCTGATTCAAAACGGCAAGG
CATATCCTGCCGCAAACGGCGACGTTTACTACGCCGTGCGCGAGTTTGCC
GCTTACGGACAATTATCGGGCAAATCGTTGGACGACCTGCGTGCGGGCGA
ACGCGTGGAAGTGGACGGTTTCAAACGCGATCCGCTTGATTTTGTATTGT
GGAAAGCGGCGAAAGCAGGCGAACCGGCGTGGGAAAGCCCGTGGGGCAAC
GGCCGTCCGGGTTGGCACATCGAATGTTCCGCGATGAGTGAAAACCTGTT
CGGCGATACGTTCGACATTCACGGCGGCGGCGCGGATTTGCAGTTCCCGC
ACCATGAAAATGAAATCGCCCAAAGCGTCGGTGCCAGCGGTCACACCTGC
GGTCATGACCACGCGCAAACCCACCACGGTCAAAGTATTGCCAGCCACGT
CAAATACTGGCTGCACAACGGCTTCATCCGTGTGGACGGCGAAAAAATGT
CCAAATCGCTGGGCAACTTCTTTACTATCCGCGAAGTATTGAAACAATAC
GACCCCGAAGTCGTGCGTTTCTTCATCCTGCGCGCCCACTACCGCAGCCC
GTTGAACTACTCCGACGCGCATTTGGACGACGCGAAAGGCGCGTTGACCC
GTCTGTACACCACCTTGAAAAACACACCGGCGGCTGAGTTTGATTTGTCT
GAAAACGCCAACGGCTACACCCGCCGTTTCTACGCCGCCATGAACGACGA
TTTCGGTACGGTCGAAGCGGTTGCCGTGTTGTTTGAGCTGGCAGGCGAAG
TGAACAAAACCAATGACGCACACCTCGCCGGCTGCCTGAAAGCTTTGGGC
GGCATCATCGGCCTGCTGCAACGCAACCCGATTGAGTTCCTCCAAGGCGG
CGCAGTTTCAGACGGCCTCTCCAACGAAGAAATCGAAGACTTGATTGCCC
GACGCAAACAGGCTCGCGCGGATAAAAACTGGGCGGAGTCCGACCGCATC
CGCGACCTTCTGAACGAACACAAAATCATTTTGGAAGACAGCGCCGGCGG
CACGACTTGGCGGCGCGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy