Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1638 IGR1635 IGR1642 IGR1640 IGR1636 IGR1637 IGR1639 IGR1643 IGR1641 IGR1644 NG1987 lpcA,gmhA,isn, - NG1986 asd, - NG1997 NG1996 exoA, - NG1994 NG1989 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 NG1987 lpcA,gmhA,isn, - NG1986 asd, - NG1997 NG1996 exoA, - NG1994 NG1989 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 lpcA,gmhA,isn, - NG1986 asd, - NG1997 NG1987 exoA, - NG1994 NG1989 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 NG1995 NG1996 NG1995
* Calculated from Protein Sequence

Gene ID: NG1992

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dcrA  

Definition:
restriction endonuclease type II NgoBI

Gene Start:
1964919

Gene Stop:
1965968

Gene Length:
1050

Molecular Weight*:
40539

pI*:
5.30

Net Charge*:
-7.66

EC:
3.1.21.4  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Stein,D.C., Gunn,J.S. and Piekarowicz,A.
Sequence similarities between the genes encoding the S.NgoI and
HaeII restriction/modification systems
Biol. Chem. 379 (4-5), 575-578 (1998)
Medline: 98290322


Comment:
For other 'dcr' genes see NG0364 (dcrG) and NG0874 (dcrD).


Oklahoma ID: NGO.1992

Blast Summary:  PSI-Blast Search
NG1992 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 5924405, a predicted type II restriction enzyme NgoBI.

No hits found to Neisseria meningitidis

One hit in gapped BLAST to restriction endonuclease sequences,e.g. residues 6-344 are 62% similar to HaeII restriction enzyme from Haemophilus influenzae (gb|AAB70830.1|)

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-344 are 62% similar to a (HAEII RESTRICTION ENZYME) protein domain (PD135136) which is seen in O30869_HAEAE.



Paralogs:  Local Blast Search


NG1992 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
160  
176
coil-coil  
310  
350

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTLEEQQAKEALDGIIKKSRVHLYKPIQIAEILYHDRCIKQLDFLNLDTY
RNQSKRWRDEICRRFLGRISTSSAKFQDNLFEKNAIPPEKLAVLGTLNRQ
SDGGVESYIYKQFFNRFSQMSEALAYVGNTDRYSFQLSEFLNLFWLEPGL
KRSIDKIYEIVVYALFDALVSELGITVSIDFPKENLFLWEEYQDFAEKII
TMPKNEHLKLPAKIHRVGVTNAADRGLDMWSNFGLAIQVKHLSLDEELAE
DIVSSISADRIVIVCKKAEQSVIVSLLTQIGWKSRIQNIVTEDDLISWYE
KALRGQYPIAEALLENIKTEIMREFPAVNEANEFLDFAQNRGYDITVTHF


Gene Nucleotide Sequence:  Sequence Viewer
ATGACGCTTGAAGAACAACAAGCCAAAGAAGCATTGGACGGCATTATCAA
AAAATCCCGTGTCCACCTTTATAAACCCATTCAAATTGCAGAAATTTTAT
ATCATGACCGTTGTATAAAACAGTTGGATTTTTTAAATTTAGATACTTAC
CGCAACCAATCTAAACGCTGGAGGGATGAAATCTGCCGTCGGTTTTTAGG
GCGGATTTCTACTTCATCTGCAAAATTCCAAGATAATCTGTTTGAAAAAA
ATGCAATACCGCCTGAAAAACTAGCGGTATTGGGAACATTAAACAGACAG
TCGGACGGCGGGGTAGAATCGTACATTTATAAACAGTTTTTCAATCGTTT
TTCCCAAATGAGCGAAGCATTGGCTTATGTCGGCAATACAGACAGATACT
CCTTCCAACTGTCTGAATTTCTAAATTTATTTTGGCTCGAGCCGGGATTG
AAAAGAAGTATAGACAAGATATATGAAATCGTTGTTTATGCGTTGTTTGA
TGCATTGGTTTCAGAATTAGGCATAACGGTTTCAATTGATTTTCCTAAGG
AAAACCTGTTTTTATGGGAGGAATATCAAGATTTTGCCGAAAAAATCATC
ACTATGCCGAAAAATGAGCATTTAAAACTTCCTGCAAAAATCCATCGTGT
AGGCGTAACCAATGCTGCCGATAGAGGGTTGGATATGTGGTCTAACTTCG
GATTGGCCATACAGGTCAAACATCTCTCTTTAGACGAAGAGTTGGCAGAA
GATATTGTATCCTCCATTAGCGCAGATAGAATTGTCATTGTCTGCAAAAA
GGCAGAACAATCGGTGATTGTTTCATTACTGACGCAAATAGGCTGGAAAA
GCCGAATTCAAAACATCGTAACTGAGGATGATTTGATAAGTTGGTACGAA
AAAGCATTGAGAGGCCAATATCCGATTGCAGAAGCGTTGTTGGAAAATAT
TAAAACTGAAATTATGCGTGAATTTCCTGCCGTTAATGAAGCCAATGAAT
TTTTAGATTTCGCCCAAAATCGCGGATATGACATTACTGTTACTCATTTC



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy