Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1638 IGR1635 IGR1642 IGR1640 IGR1636 IGR1637 IGR1639 IGR1634 IGR1643 IGR1641 NG1987 lpcA,gmhA,isn, - NG1986 NG1985 asd, - NG1997 NG1996 exoA, - NG1994 NG1989 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 NG1987 lpcA,gmhA,isn, - NG1986 NG1985 asd, - NG1997 NG1996 exoA, - NG1994 NG1989 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 lpcA,gmhA,isn, - NG1986 NG1985 asd, - NG1997 NG1987 exoA, - NG1994 NG1989 NG1988 ngoI,dcm, - NG1991 dcrA, - NG1992 NG1990 cysS, - NG1993 NG1995 NG1996 NG1995
* Calculated from Protein Sequence

Gene ID: NG1991

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ngoI  dcm  

Definition:
cytosine DNA methylase M.NgoI

Gene Start:
1963975

Gene Stop:
1964919

Gene Length:
945

Molecular Weight*:
35297

pI*:
6.80

Net Charge*:
-0.40

EC:
2.1.1.37  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Methionine metabolism

Primary Evidence:
Stein,D.C., Gunn,J.S. and Piekarowicz,A.
Sequence similarities between the genes encoding the S.NgoI and
HaeII restriction/modification systems.
Biol. Chem. 379 (4-5), 575-578 (1998)
Medline: 98290322

Labbe,D., Holtke,H.J. and Lau,P.C.
Cloning and characterization of two tandemly arranged DNA
methyltransferase genes of Neisseria lactamica: an adenine-specific M.NlaIII and a cytosine-type methylase
Mol. Gen. Genet. 224 (1), 101-110 (1990)
Medline: 91117164

Stein,D.C., Gunn,J.S., Radlinska,M. and Piekarowicz,A.
Restriction and modification systems of Neisseria gonorrhoeae
Gene 157 (1-2), 19-22 (1995)
Medline: 95331562

Sullivan,K.M. and Saunders,J.R.
Sequence analysis of the NgoPII methyltransferase gene from
Neisseria gonorrhoeae P9: homologies with other enzymes recognizing the sequence 5'-GGCC-3'
Nucleic Acids Res. 16 (10), 4369-4387 (1988)
Medline: 88247748

Sullivan,K.M. and Saunders,J.R.
Nucleotide sequence and genetic organization of the NgoPII
restriction-modification system of Neisseria gonorrhoeae
Mol. Gen. Genet. 216 (2-3), 380-387 (1989)
Medline: 89313677

Gunn,J.S. and Stein,D.C.
Natural variation of the NgoII restriction-modification system of
Neisseria gonorrhoeae
Gene 132 (1), 15-20 (1993)
Medline: 94010340

Stein,D.C., Chien,R. and Seifert,H.S.
Construction of a Neisseria gonorrhoeae MS11 derivative deficient
in NgoMI restriction and modification
J. Bacteriol. 174 (15), 4899-4906 (1992)
Medline: 92332422




Secondary Evidence:
Som,S., Bhagwat,A.S. and Friedman,S.
Nucleotide sequence and expression of the gene encoding the EcoRII
modification enzyme
Nucleic Acids Res. 15 (1), 313-332 (1987)
Medline: 87146340


Comment:
For other 'ngo'genes see NG0675 (rngoV), NG0676 (mngoV),NG1795 (NgoPII).

For other 'dcm' genes see NG0365 (dcmG), NG0873 (dcmD) ,NG1795
(dcmH) , NG1893 (damH) and NG1894 (dcmH).

Oklahoma ID: NGO.1991

N.meningitidis?

Blast Summary:  PSI-Blast Search
NG1991 is 95% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 5924404, a predicted M.NgoI enzyme. See also g12229863, g11386930, g462655, g400287

Several matches in gapped BLAST to DNA-related mathylases. Residues 2-313 are 74% similar to a methylase from H.influenzae (gb|AAB70829).

Residues 1-306 are 48% similar to MTNX_NEILA (X54485). Residues 5-302 are 41% similar to 7380148 in N.meningitidis, suggesting no ortholog for this Ngo enzyme.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0270
COG name: Site-specific DNA methylase dcm
Functional Class:  L
The phylogenetic pattern of COG0270 is -Mtk---ceB-hUJ-------
Number of proteins in this genome belonging to this COG is 8

Blocks Summary:  Blocks Search
***** IPB001525 (C-5 cytosine-specific DNA methylase) with a combined E-value of 4e-62.
    IPB001525A    5-18
    IPB001525B    63-78
    IPB001525C    87-114
    IPB001525D    134-160
    IPB001525E    249-264
    IPB001525F    276-285


ProDom Summary:  Protein Domain Search
Residues 64-164 are 99% similar to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000445) which is seen in Q59603_NEIGO.

Residues 249-299 are 86% similar to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000554) which is seen in O30868_HAEAE.

Residues 182-248 are 82% similar to a (METHYLTRANSFERASE METHYLASE HAEII MODIFICATION) protein domain (PD032816) which is seen in Q59603_NEIGO.

Residues 247-299 are 49% similar to a (METHYLTRANSFERASE MODIFICATION METHYLASE) protein domain (PD154973) which is seen in MTN4_NEILA.

Residues 5-63 are 83% similar to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000515) which is seen in O30868_HAEAE.



Paralogs:  Local Blast Search


NG1991 is paralogously related to NG0676 (modification methylase M.NgoV (site-specific DNA-methyltransferase)) (8e-50), NG0365 (site-specific DNA-methyltransferase (cytosine-specific) NgoVII) (2e-38), NG1894 (5-methylcytosine methyltransferase) (3e-32), NG1795 (site-specific DNA-methyltransferase (cytosine-specific)) (2e-31), NG1209 (DNA (cytosine-5-)-methyl transferase) (3e-23) and NG0873 (DNA modification methylase) (7e-23).


Pfam Summary:  Pfam Search
Residues 2 to 297 (E-value = 4.1e-112) place NG1991 in the DNA_methylase family which is described as C-5 cytosine-specific DNA methylase (PF00145)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|10MH|10MH-A TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH245.0 6e-66
pdb|1FJX|1FJX-A STRUCTURE OF TERNARY COMPLEX OF HHAI 245.0 8e-66
pdb|1DCT|1DCT-A DNA (CYTOSINE-5) METHYLASE FROM HAEIII 130.0 3e-31
pdb|10MH|10MH-A TERN

Gene Protein Sequence:
MYKTIDLFSGIGGIRLGFEKYGCTNVFSSEWDKYARQVYEANFGEKPFGD
INGIDPSDIPDHDILLAGFPCQPFSIAGKGLGFEDTRGTLFFNIAEILKT
KQPKAFLLENVKRLTTHDSGRTFRIILETLKQLGYTVYFKVLNTLDFGLP
QKRERIYIVGFSDNIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTLK
QKRLAALKKAPPTPSIWHENIGGNVSALPYSCALRAGGSYNYLVVNGVRR
LTGREMLRLQGFPDDFEINIPYSQVRKVAGNSVSVPVIEAIAENMLASLS
GKVEQKGQLDLLEAG

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACAAAACAATAGATTTATTTTCAGGCATTGGCGGAATACGCCTAGG
CTTTGAAAAATACGGGTGCACCAATGTATTCTCATCGGAATGGGACAAAT
ATGCCCGACAAGTGTATGAAGCAAACTTTGGAGAAAAACCTTTTGGCGAC
ATTAACGGCATCGATCCTTCAGATATTCCCGATCATGATATTCTGCTTGC
GGGATTTCCGTGCCAACCTTTCAGTATCGCAGGTAAGGGATTGGGATTTG
AAGATACGCGCGGAACATTGTTTTTCAATATTGCCGAAATCCTGAAAACC
AAACAGCCGAAGGCTTTTCTTCTGGAAAACGTTAAGCGGCTGACTACGCA
CGATTCGGGCAGGACTTTCCGTATTATTTTAGAAACCCTTAAACAGCTTG
GTTATACGGTTTATTTTAAGGTTTTAAATACTTTGGATTTCGGATTGCCG
CAAAAACGCGAGAGAATTTATATTGTGGGTTTTTCAGACAACATCCCTTT
TTACTTTCCCGAACCCATAAACCAATATCGGCCATTGGGCGAACTGCTGG
AAAACGATCGAGATGTCGAACCAAGCTATTTTTTATCAGATACCTTGAAA
CAAAAACGTTTGGCAGCCTTAAAAAAAGCTCCGCCCACCCCATCAATTTG
GCATGAAAATATTGGCGGGAATGTTTCCGCACTTCCATATTCCTGTGCCT
TAAGGGCCGGGGGAAGTTACAATTATTTGGTGGTAAACGGAGTAAGAAGG
CTAACAGGAAGGGAAATGTTAAGATTACAAGGTTTTCCCGATGATTTTGA
AATCAATATCCCCTACTCGCAAGTCAGGAAAGTCGCCGGAAATTCTGTAT
CCGTCCCTGTAATAGAAGCCATCGCGGAAAATATGCTCGCTTCTCTTTCC
GGCAAGGTCGAACAAAAAGGGCAATTGGATTTATTGGAGGCAGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy