Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1638 IGR1635 IGR1633 IGR1636 IGR1637 IGR1630 IGR1627 IGR1634 IGR1631 IGR1632 IGR1626 IGR1629 IGR1628 NG1976 NG1982 NG1987 lecA, - NG1981 lpcA,gmhA,isn, - NG1986 NG1979 NG1985 map, - NG1983 NG1984 NG1978 NG1977 NG1989 NG1988 NG1990 mqo,yojH, - NG1980 NG1976 NG1982 NG1987 lecA, - NG1981 lpcA,gmhA,isn, - NG1986 NG1979 NG1985 map, - NG1983 NG1984 NG1978 NG1977 NG1989 NG1988 NG1990 mqo,yojH, - NG1980 Type: tandem, Name:  - 90 Type: tandem, Name:  - 91 NG1976 lecA, - NG1981 lpcA,gmhA,isn, - NG1986 NG1979 NG1985 map, - NG1983 NG1984 NG1982 NG1987 NG1978 NG1977 NG1988 NG1990 mqo,yojH, - NG1980 NG1989
* Calculated from Protein Sequence

Gene ID: NG1983

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
map  

Definition:
methionine aminopeptidase (Met-AP)

Gene Start:
1958553

Gene Stop:
1957909

Gene Length:
645

Molecular Weight*:
23113

pI*:
7.80

Net Charge*:
3.16

EC:
3.4.11.18  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Ben-Bassat,A., Bauer,K., Chang,S.Y., Myambo,K., Boosman,A. and
Chang,S..
Processing of the initiation methionine from proteins: properties of the Escherichia coli methionine aminopeptidase and its gene structure.
J. Bacteriol. 169 (2), 751-757 (1987)
Medline: 87109068

Chung JM, Chung IY, Lee YS.
The purification and characterization of a Bacillus stearothermophilus methionine aminopeptidase (MetAP).
J Biochem Mol Biol. 2002 Mar;35(2):228-35.
PMID: 12297034

Cosper NJ, D'souza VM, Scott RA, Holz RC.
Structural evidence that the methionyl aminopeptidase from Escherichia coli is a mononuclear metalloprotease.
Biochemistry. 2001 Nov;40(44):13302-9.
PMID: 11683640

Van Valkenburgh HA, Kahn RA.
Coexpression of proteins with methionine aminopeptidase and/or N-myristoyltransferase in Escherichia coli to increase acylation and homogeneity of protein preparations.
Methods Enzymol. 2002;344:186-93.
PMID: 11771383

Comment:
This protein is predicted to remove the amino-terminal methionine from nascent proteins.

Oklahoma ID: NGO.1983c

Check start codon.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to Map proteins. Residues 26-208 are 63% similar to the enzyme from P.aeruginosa (gb|AAG07045).

Residues 26-215 are 98% similar to NMB2093 in N.meningitidis (gb|AAF42410).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0024
COG name: Methionine aminopeptidase
Functional Class:  J
The phylogenetic pattern of COG0024 is amtkYqvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002467 (Methionine aminopeptidase, subfamily 1) with a combined E-value of 4.3e-94.
    IPB002467B    20-41
    IPB002467C    46-74
    IPB002467D    119-144
    IPB002467E    153-165
    IPB002467F    177-207
***** PR00599 (Methionine aminopeptidase-1 signature) with a combined E-value of 1.8e-33.
    PR00599A    28-41
    PR00599B    50-66
    PR00599C    120-132
    PR00599D    151-163
***** IPB001131 (Proline dipeptidase) with a combined E-value of 7.4e-12.
    IPB001131B    50-71
    IPB001131C    125-137
    IPB001131D    153-166
    IPB001131E    189-207


ProDom Summary:  Protein Domain Search
Residues 26-136 are 62% similar to a (AMINOPEPTIDASE HYDROLASE PROTEIN METHIONINE PEPTIDASE) protein domain (PD000555) which is seen in AMPM_RICPR.

Residues 141-208 are 61% similar to a (AMINOPEPTIDASE METHIONINE MAP HYDROLASE COBALT PEPTIDASE) protein domain (PD102788) which is seen in AMPM_HAEIN.



Paralogs:  Local Blast Search


NG1983 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 124 to 197 (E-value = 1.1e-23) place NG1983 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
11

PDB Hit:
pdb|1MAT|1MAT METHIONINE AMINOPEPTIDASE (E.C.3.4.11.18) 236.0 2e-63
pdb|3MAT|3MAT-A E.COLI METHIONINE AMINOPEPTIDASE 235.0 6e-63
pdb|4MAT|4MAT-A E.COLI METHIONINE AMINOPEPTIDASE HIS79ALA MUTANT235.0 6e-63
pdb|2MAT|2MAT-A E.CO

Gene Protein Sequence:
LFTTTTSTSKAAIPPPLHYGNPPYPKSCCTSVNHVICHGIPDDKPLKEGD
IINIDLTIKKDGFHGDSSRMFTVGKVSPIAQRLIDVTHASMMAGIEAVKP
GATLGGVGYACQQVAENAGYSVVQEFCGHGIGRGFHEAPQVLHYGKKGQG
PVLKPGMIFTVEPMINQGKRHLRILNDGWTVVTKDRSLSAQWEHEVLVTE
TGYEILTVSPATGKP

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTTACGACTACCACGTCAACGTCCAAGGCGGCTATCCCGCCCCCCCT
CCACTACGGCAACCCGCCCTACCCCAAATCCTGCTGCACCTCCGTCAACC
ACGTCATCTGCCACGGCATTCCCGACGACAAGCCGCTCAAAGAAGGTGAC
ATTATCAACATCGACCTCACCATCAAAAAAGACGGTTTCCACGGCGACTC
CAGCCGTATGTTTACCGTCGGCAAAGTCTCCCCCATCGCCCAACGCCTGA
TCGACGTAACCCACGCCTCTATGATGGCGGGCATAGAAGCCGTCAAACCT
GGCGCGACGCTGGGCGGCGTAGGTTACGCCTGCCAGCAGGTTGCCGAAAA
TGCAGGTTATTCGGTTGTACAAGAATTCTGCGGACACGGCATCGGGCGCG
GTTTCCACGAAGCCCCGCAAGTGTTGCACTACGGAAAAAAAGGGCAGGGT
CCCGTTCTAAAACCGGGTATGATTTTTACCGTCGAACCGATGATCAACCA
AGGCAAACGCCACCTGCGTATCCTCAACGACGGCTGGACGGTGGTTACCA
AAGACCGCTCCCTCTCCGCCCAATGGGAACACGAAGTCTTGGTAACCGAA
ACCGGCTACGAAATCCTCACCGTCAGCCCCGCCACCGGCAAACCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy