Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1635 IGR1633 IGR1630 IGR1627 IGR1634 IGR1631 IGR1625 IGR1632 IGR1626 IGR1629 IGR1624 IGR1628 NG1976 NG1982 NG1987 lecA, - NG1981 lpcA,gmhA,isn, - NG1986 NG1979 NG1985 map, - NG1983 NG1984 pyrH,smbA, - NG1973 rpsB, - NG1975 tsf,EF-Tu, - NG1974 NG1978 NG1977 mqo,yojH, - NG1980 NG1976 NG1982 NG1987 lecA, - NG1981 lpcA,gmhA,isn, - NG1986 NG1979 NG1985 map, - NG1983 NG1984 pyrH,smbA, - NG1973 rpsB, - NG1975 tsf,EF-Tu, - NG1974 NG1978 NG1977 mqo,yojH, - NG1980 Type: tandem, Name:  - 90 Type: tandem, Name:  - 91 NG1976 lecA, - NG1981 lpcA,gmhA,isn, - NG1986 NG1979 NG1985 map, - NG1983 NG1984 pyrH,smbA, - NG1973 rpsB, - NG1975 tsf,EF-Tu, - NG1974 NG1982 NG1987 NG1978 NG1977 mqo,yojH, - NG1980
* Calculated from Protein Sequence

Gene ID: NG1980

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mqo  yojH  

Definition:
malate:quinone oxidoreductase

Gene Start:
1955243

Gene Stop:
1956706

Gene Length:
1464

Molecular Weight*:
54148

pI*:
6.00

Net Charge*:
-6.45

EC:
1.1.99.16  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Pyruvate metabolism

Secondary Evidence:
Kretzschmar U, Rückert A, Jeoung JH, Görisch H.
Malate:quinone oxidoreductase is essential for growth on ethanol or acetate in Pseudomonas aeruginosa.
Microbiology. 2002 Dec;148(Pt 12):3839-47.
PMID: 12480887

van der Rest ME, Frank C, Molenaar D.
Functions of the membrane-associated and cytoplasmic malate dehydrogenases in the citric acid cycle of Escherichia coli.
J Bacteriol. 2000 Dec;182(24):6892-9.
PMID: 11092847

Molenaar D, van der Rest ME, Drysch A, Yücel R.
Functions of the membrane-associated and cytoplasmic malate dehydrogenases in the citric acid cycle of Corynebacterium glutamicum.
J Bacteriol. 2000 Dec;182(24):6884-91.
PMID: 11092846

Kather B, Stingl K, van der Rest ME, Altendorf K, Molenaar D.
Another unusual type of citric acid cycle enzyme in Helicobacter pylori: the malate:quinone oxidoreductase.
J Bacteriol. 2000 Jun;182(11):3204-9.
PMID: 10809701

Comment:
Oklahoma ID: NGO.1980

Supplements MDH (1.1.1.37; NG0240)) under certain conditions.

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to malate dehydrogenase (acceptor). Residues 6-488 are 47% similar to the enzyme from P.aeruginosa (gb|AAG06840).

Residues 1-488 are 90% similar to NMA0333 in N.meningitidis (AL162752).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0579
COG name: Predicted dehydrogenase
Functional Class:  R
The phylogenetic pattern of COG0579 is a-----vcE-r-ujgp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-160 are 25% similar to a (PROTEIN MG039 CONSERVED PUTATIVE) protein domain (PD011272) which is seen in O24913_HELPY.

Residues 5-488 are 47% similar to a (MALATE:QUINONE OXIDOREDUCTASE MALATE) protein domain (PD025330) which is seen in Q9Z9Q7_BBBBB.



Paralogs:  Local Blast Search


NG1980 is paralogously related to NG1959 (hypothetical protein) (3e-05).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
48
transmembrane  
7  
23

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MAEATDVVLVGGGIMSATLGVLLKELEPSWEITLIERLEDVALESSNAWN
NAGTGHSALCELNYAPLGADGVINPARALNIAEQFHVSRQFWATLVAEGK
LEDNSFINAVPHMSLVMNEDHCRYLQKRYDVFKTQKLFENMEFSTDRNKI
SDWAPLIMRGRDENQPVAANYSAEGTDVDFGRLTRQMVKYLQGKGVKTEF
NRHVEDIKRESDGAWVLKTADTRNPDWQLTLRTRFLFLGAGGGALTLLQK
SGIPEGKGYGGLPVSGLFFRNSNPETAEQHNAKVYGQASVGAPPMSVPHL
DTRNVDGKRHLMFGPYAGFRSNFLKQGSFMDLPLSIHMDNLYPMLRAGWA
NMPLTKYLLGELRKTKEERFASLLEYYPEANPDDWELITAGQRVQIIKKD
SEKGGVLQFGTEIVAHADGSLAALLGASPGASTAVPLMIRLMHQCFPERA
PSWEGRLKELVPGYGIKLNENPERADEIIAYTAKVLDI

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGAAGCGACAGACGTTGTCTTGGTGGGCGGCGGCATTATGAGCGC
GACTTTGGGCGTTTTGCTCAAAGAACTCGAACCGTCTTGGGAAATCACCC
TGATTGAACGCTTGGAAGATGTGGCGTTGGAATCGTCAAACGCGTGGAAC
AACGCCGGCACGGGGCATTCCGCGCTGTGCGAATTGAACTATGCGCCGCT
GGGTGCGGACGGCGTCATCAATCCGGCGCGCGCCCTGAATATTGCCGAAC
AGTTTCATGTCAGCCGCCAGTTTTGGGCGACGCTGGTCGCGGAAGGCAAG
TTGGAAGACAATTCCTTCATCAATGCCGTGCCGCATATGTCTTTGGTGAT
GAACGAAGACCACTGCCGTTACCTGCAAAAACGCTATGATGTGTTTAAAA
CGCAGAAACTTTTTGAAAATATGGAATTTTCCACCGATCGGAACAAAATT
TCCGATTGGGCTCCGCTGATTATGCGCGGCCGGGACGAAAACCAACCCGT
CGCCGCCAACTATTCCGCCGAAGGCACGGATGTCGATTTCGGACGGCTGA
CGCGCCAGATGGTGAAATATTTGCAGGGCAAGGGCGTAAAAACCGAGTTC
AACCGCCACGTCGAAGACATCAAACGCGAATCCGACGGCGCGTGGGTGCT
CAAAACCGCCGATACCCGCAACCCAGACTGGCAGCTCACCCTCCGCACCC
GCTTCCTCTTCCTCGGCGCGGGCGGCGGCGCACTGACCCTGCTGCAAAAA
TCCGGCATCCCCGAAGGCAAAGGCTACGGCGGCTTACCCGTGTCCGGCCT
GTTCTTCCGCAACAGCAACCCCGAAACCGCCGAACAACACAACGCCAAAG
TGTACGGGCAGGCTTCCGTCGGCGCGCCGCCGATGTCCGTCCCGCACCTC
GACACACGCAACGTAGACGGCAAACGACACCTTATGTTCGGTCCTTACGC
AGGTTTCCGTTCCAACTTCCTCAAGCAAGGCTCGTTTATGGATTTGCCGC
TGTCCATCCATATGGACAACCTCTATCCTATGCTGCGCGCCGGCTGGGCG
AATATGCCGCTGACCAAATACCTGCTGGGCGAATTGCGTAAAACCAAAGA
AGAACGCTTTGCCTCCCTGCTGGAATACTACCCCGAGGCAAACCCCGACG
ACTGGGAACTCATCACCGCAGGGCAACGCGTCCAAATCATTAAAAAAGAC
TCCGAAAAAGGCGGCGTGCTGCAGTTTGGTACGGAGATTGTCGCCCACGC
CGACGGCTCGCTCGCCGCATTGCTGGGAGCGTCGCCGGGCGCATCGACCG
CTGTGCCGCTGATGATCCGGCTGATGCACCAATGCTTCCCCGAGCGCGCC
CCGTCTTGGGAAGGTCGTCTGAAAGAGCTGGTACCGGGTTACGGCATCAA
GTTGAACGAAAACCCTGAAAGGGCGGATGAAATTATCGCCTATACCGCGA
AAGTGTTGGATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy