Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1621 IGR1622 IGR1627 IGR1619.1 IGR1620 IGR1625 IGR1623 IGR1626 IGR1624 IGR1628 IGR1619 NG1969 NG1976 NG1970 NG1979 pyrH,smbA, - NG1973 rpsB, - NG1975 tsf,EF-Tu, - NG1974 mafB, - NG1968 mafA, - NG1972 mafB, - NG1971 NG1978 NG1977 mqo,yojH, - NG1980 NG1969 NG1976 NG1970 NG1979 pyrH,smbA, - NG1973 rpsB, - NG1975 tsf,EF-Tu, - NG1974 mafB, - NG1968 mafA, - NG1972 mafB, - NG1971 NG1978 NG1977 mqo,yojH, - NG1980 Type: tandem, Name:  - 90 Type: inverse, Name:  - 140 NG1976 NG1970 NG1979 pyrH,smbA, - NG1973 rpsB, - NG1975 tsf,EF-Tu, - NG1974 mafB, - NG1968 mafA, - NG1972 mafB, - NG1971 NG1969 NG1978 NG1977 mqo,yojH, - NG1980
* Calculated from Protein Sequence

Gene ID: NG1973

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrH  smbA  

Definition:
uridylate kinase (PyrH)

Gene Start:
1951215

Gene Stop:
1950499

Gene Length:
717

Molecular Weight*:
25700

pI*:
7.30

Net Charge*:
0.34

EC:
2.7.4.-  

Functional Class:
Cellular processes; Cell division  
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table

Secondary Evidence:
Serina,L., Blondin,C., Krin,E., Sismeiro,O., Danchin,A.,
Sakamoto,H., Gilles,A.M. and Barzu,O.
Escherichia coli UMP-kinase, a member of the aspartokinase family,
is a hexamer regulated by guanine nucleotides and UTP
Biochemistry 34 (15), 5066-5074 (1995)
Medline: 95226394

Yamanaka,K., Ogura,T., Niki,H., Hiraga,S.
Identification and characterization of the smbA gene, a suppressor
of the mukB null mutant of Escherichia coli.
J. Bacteriol. 174(23): 7517-7526, 1992.
Medline: 1447125.


Comment:
Oklahoma ID: NGO.1973c


For other 'pyr' genes, see NG0029 (pyrE), NG0255 (pyrC), NG0401 (pyrF), NG0589 (pyrP), NG1212 (pyrG), NG1761 (pyrD), NG1876 (pyrI).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to uridylate kinases. Residues 6-237 are 51% similar to the enzyme from Caulobacter crescentus (gb|AAK23896).

Residues 1-239 are 90% similar to NMA0326 in N.meningitidis (gb|AAF42420).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0528
COG name: Uridylate kinase
Functional Class:  F
The phylogenetic pattern of COG0528 is amtk-qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001057 (Glutamate 5-kinase) with a combined E-value of 1.3e-07.
    IPB001057A    32-57
    IPB001057C    140-173


ProDom Summary:  Protein Domain Search
Residues 84-237 are 54% similar to a (KINASE TRANSFERASE BIOSYNTHESIS ASPARTOKINASE GLUTAMATE) protein domain (PD000447) which is seen in O31749_BACSU.

Residues 4-83 are 40% similar to a (KINASE URIDYLATE UMP TRANSFERASE) protein domain (PD005760) which is seen in O82852_PSEAE.



Paralogs:  Local Blast Search


NG1973 is paralogously related to NG0956 (aspartokinase, alpha and beta chains) (8e-09) and NG0849 (gamma-glutamyl kinase) (2e-04).


Pfam Summary:  Pfam Search
Residues 8 to 217 (E-value = 4.2e-64) place NG1973 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTQQIKYKRVLLKLSGESLMGSDPFGINHDTIVQTVGEIAEIVKMGVQVG
IVVGGGNIFRGVSAQAGSMDRATADYMGMMATVMNALALKDAFETLGIKA
RVQSALSMQQIAETYARPKAIQYLEEGKVVIFAAGTGNPFFTTDTAAALR
GAEMNCDVMLKATNVDGVYTADPKKDPSATRYETITFDEALNKNLKVMDA
TAFALCRERKLNIVVFGIAKQGSLKRVITGEDEGTLVHC

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACAGCAAATCAAATACAAACGCGTATTACTGAAACTCTCCGGCGA
ATCCCTGATGGGTTCCGATCCGTTCGGCATCAATCACGATACCATTGTTC
AAACTGTCGGCGAAATTGCCGAAATCGTGAAAATGGGTGTGCAAGTCGGT
ATCGTTGTCGGCGGCGGTAACATTTTCCGCGGCGTATCTGCACAAGCAGG
CAGCATGGACCGCGCCACTGCCGACTACATGGGCATGATGGCGACCGTGA
TGAACGCCTTGGCACTCAAAGACGCATTTGAAACCTTGGGCATCAAAGCG
CGCGTACAATCCGCACTGTCTATGCAGCAAATCGCTGAAACTTACGCCCG
TCCTAAAGCCATTCAATATTTGGAAGAAGGCAAAGTCGTGATTTTCGCCG
CCGGTACCGGTAATCCGTTCTTCACGACCGACACTGCCGCCGCATTGCGC
GGCGCGGAAATGAACTGCGACGTGATGCTCAAAGCCACCAACGTCGACGG
CGTGTACACCGCAGACCCGAAAAAAGACCCGTCCGCCACACGCTACGAAA
CCATTACTTTTGACGAAGCCTTGAATAAAAACCTCAAAGTCATGGACGCG
ACCGCCTTTGCCCTCTGCCGCGAACGCAAGCTCAATATCGTCGTCTTCGG
CATCGCCAAACAAGGCTCGCTCAAACGCGTCATTACCGGCGAAGACGAAG
GCACACTGGTCCACTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy