Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1610 IGR1614 IGR1613 IGR1617 IGR1611 IGR1612 IGR1618 IGR1616 IGR1615 NG1966 NG1967 NG1965 NG1967.1 mafB, - NG1966.1 argG, - NG1961 NG1959 NG1960 NG1964 NG1962 sohB, - NG1963 GNA2132, - NG1958 NG1966 NG1967 NG1965 NG1967.1 mafB, - NG1966.1 argG, - NG1961 NG1959 NG1960 NG1964 NG1962 sohB, - NG1963 GNA2132, - NG1958 NG1965 NG1967.1 mafB, - NG1966.1 argG, - NG1961 NG1966 NG1967 NG1960 NG1964 NG1962 sohB, - NG1963 GNA2132, - NG1958 NG1959
* Calculated from Protein Sequence

Gene ID: NG1963

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sohB  

Definition:
possible secreted proteinase

Gene Start:
1939923

Gene Stop:
1940906

Gene Length:
984

Molecular Weight*:
35950

pI*:
10.20

Net Charge*:
10.65

EC:
3.4.-.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Biotin metabolism
Lysine degradation

Secondary Evidence:
Baird,L., Lipinska,B., Raina,S. and Georgopoulos,C.
Identification of the Escherichia coli sohB gene, a
multicopy suppressor of the HtrA (DegP) null phenotype J. Bacteriol. 173 (18), 5763-5770 (1991)
Medline: 91358368

Comment:
Oklahoma ID: NGO.1963

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to proteases. Residues 8-324 are 35% similar to peptidase PA2973 in Pseudomonas aeruginosa (gb|AAG06361).

Residues 1-328 are greater than 90% similar to NMB2127 in N.meningitidis (gb|AAF42435).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0616
COG name: Periplasmic serine proteases
Functional Class:  N
The phylogenetic pattern of COG0616 is aMtK-QvCEBrHuj---linX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002142 (Peptidase family U7) with a combined E-value of 4.9e-48.
    IPB002142A    116-125
    IPB002142B    151-200
    IPB002142C    260-286


ProDom Summary:  Protein Domain Search
Residues 147-288 are 31% similar to a (PROTEASE IV HYDROLASE PROTEIN ENDOPEPTIDASE) protein domain (PD002897) which is seen in Q9ZDD3_RICPR.



Paralogs:  Local Blast Search


NG1963 is paralogously related to NG1246 (possible serine proteinase (SOHB)) (2e-12).


Pfam Summary:  Pfam Search
Residues 141 to 296 (E-value = 3.7e-36) place NG1963 in the Peptidase_S49 family which is described as Peptidase family S49 (PF01343)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
47  
63

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MQYRIRRENEAPEAKNAGETLWERDIMREVLLSAYRDRRRERMWKNIWRA
VSTLILVALIAGIFRKDEAALQLAGNTPHTAVVNLYGKIGNGVEDQVKKL
KDGMEAAYKNPQAKAIVIRANSPGGSPVVSNTAFEEIRRLKAQHPGIPVY
LVAEDMCASGCYYIAAAADKIYADPSSIVGSIGVIGSSFDATGLMEKIGV
KRRVKIAGSNKGMGDPFSPETPEQSKIWEEMLTGIHGEFIKAVKTGRGGR
LKFRQYPDVFSGRVYTGADALKVGLVDGLGNIYSVARDVVKAPDVVDYTP
KDDFGRILGRRFGAELKASVSEALQAVR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATACCGAATCAGAAGAGAAAACGAAGCACCCGAAGCAAAAAATGC
GGGGGAAACCTTATGGGAGCGCGACATTATGCGCGAAGTGCTGCTGTCCG
CCTATCGGGACAGGCGCAGGGAGCGGATGTGGAAAAACATCTGGCGCGCC
GTCAGCACCCTGATTCTGGTTGCCCTGATTGCAGGCATTTTCCGAAAAGA
CGAAGCCGCATTGCAGTTGGCGGGCAACACGCCGCATACCGCAGTCGTCA
ACCTGTACGGCAAAATCGGCAACGGCGTAGAAGACCAGGTCAAAAAACTC
AAAGACGGGATGGAGGCCGCCTACAAAAACCCGCAGGCAAAAGCCATCGT
CATCCGCGCCAACAGCCCCGGCGGTTCGCCCGTCGTCTCCAACACCGCTT
TTGAAGAAATACGCCGTCTGAAGGCGCAGCACCCCGGCATCCCCGTTTAT
CTCGTGGCAGAGGATATGTGCGCGTCCGGCTGCTACTACATCGCGGCGGC
GGCGGACAAAATCTATGCCGACCCGTCCAGCATCGTCGGCAGCATCGGCG
TTATCGGCAGCAGTTTCGACGCGACCGGCCTGATGGAAAAAATCGGCGTA
AAACGCAGGGTTAAAATTGCGGGCAGCAACAAAGGCATGGGCGATCCGTT
TTCGCCCGAAACGCCCGAACAGTCGAAAATCTGGGAAGAAATGCTGACCG
GCATACACGGCGAATTTATCAAAGCCGTCAAAACCGGACGCGGCGGCCGC
CTCAAATTCCGACAATATCCCGACGTGTTCAGCGGTCGCGTGTACACAGG
CGCGGACGCGCTGAAAGTCGGGCTGGTGGACGGACTCGGCAATATTTACA
GCGTGGCGCGAGACGTGGTCAAAGCTCCCGATGTGGTGGATTACACTCCG
AAGGACGATTTCGGCAGAATCTTGGGCAGACGCTTCGGAGCAGAACTCAA
AGCAAGCGTTTCGGAAGCTCTGCAGGCCGTCCGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy