Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1610 IGR1614 IGR1609 IGR1613 IGR1617 IGR1611 IGR1608 IGR1612 IGR1616 IGR1615 NG1966 NG1965 argG, - NG1961 NG1956 NG1959 NG1960 NG1964 NG1962 sohB, - NG1963 NG1957 GNA2132, - NG1958 NG1966 NG1965 argG, - NG1961 NG1956 NG1959 NG1960 NG1964 NG1962 sohB, - NG1963 NG1957 GNA2132, - NG1958 NG1965 argG, - NG1961 NG1956 NG1966 NG1960 NG1964 NG1962 sohB, - NG1963 NG1957 GNA2132, - NG1958 NG1959
* Calculated from Protein Sequence

Gene ID: NG1961

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argG  

Definition:
argininosuccinate synthase

Gene Start:
1938958

Gene Stop:
1937618

Gene Length:
1341

Molecular Weight*:
49678

pI*:
5.10

Net Charge*:
-12.12

EC:
6.3.4.5  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Alanine and aspartate metabolism
Arginine and proline metabolism
Urea cycle and metabolism of amino groups

Secondary Evidence:
Van Vliet,F., Crabeel,M., Boyen,A., Tricot,C., Stalon,V.,
Falmagne,P., Nakamura,Y., Baumberg,S. and Glansdorff,N.
Sequences of the genes encoding argininosuccinate synthetase in
Escherichia coli and Saccharomyces cerevisiae: comparison with
methanogenic archaebacteria and mammals.
Gene 95 (1), 99-104 (1990)
Medline: 91071613.

Comment:
See also: ArgA, NG0027; ArgB, NG0844; ArgC, NG0118; ArgD, NG0646; ArgF, NG1232; ArgH, NG0219; ArgJ, NG1194.

Oklahoma ID: NGO.1961c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to argininosuccinate synthase sequences. Residues 4-446 are 84% similar to ASSY_PASMU (gb|AAK02897).

Residues 1-447 are virtually identical to NMA0303 in N.meningitidis (AL162752).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0137
COG name: Argininosuccinate synthase
Functional Class:  E
The phylogenetic pattern of COG0137 is amt-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001518 (Argininosuccinate synthase) with a combined E-value of 1.3e-112.
    IPB001518A    19-30
    IPB001518B    38-50
    IPB001518C    54-96
    IPB001518D    106-144
    IPB001518E    192-208
    IPB001518F    237-250
    IPB001518G    268-311
    IPB001518H    333-342
    IPB001518I    359-370


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1961 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 422 (E-value = 1.1e-189) place NG1961 in the Arginosuc_synth family which is described as Arginosuccinate synthase (PF00764)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1K92|1K92-A CRYSTAL STRUCTURE OF UNCOMPLEXED E. COLI 707.0 0.000000
pdb|1KH1|1KH1-A CRYSTAL STRUCTURE OF THERMUS THERMOPHILUS HB8 165.0 1e-41
pdb|1K92|1K92-A CRYSTAL STRUCTURE OF UNCOMPLEXED E. COLI 713.0 0.000000
pdb|1KH1|1KH1-A

Gene Protein Sequence:
MNQNHTILQNLPVGQKVGIAFSGGLDTSAALLWMKLKGALPYAYTANLGQ
PDEDDYNAIPKKAMEYGAENARLIDCRAQLAHEGIAAIQCGAFHVSTGGI
AYFNTTPLGRAVTGTMLVSAMKEDDVNIWGDGSTYKGNDIERFYRYGLLT
NPALKIYKPWLDQQFIDELGGRHEMSEFLIANGFNYKMSVEKAYSTDSNM
LGATHEAKDLEFLNSGIKIVKPIMGVAFWDENVEIEPEEVSVRFEEGVPV
ALNGKEYADPVELFLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGM
ALFHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDSQALMLRET
AQRWVAKAVTGEVTLELRRGNDYSILNTESPNLTYQPERLSMEKVEGAAF
TPLDRIGQLTMRNLDITDTRAKLGIYSQSGLLSLGEGSVLPQLGNKQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCAAAACCATACTATTTTACAAAACCTCCCCGTCGGTCAGAAAGT
CGGCATCGCCTTCTCCGGCGGTCTTGATACCTCTGCCGCGCTGTTGTGGA
TGAAACTCAAAGGCGCGCTGCCTTATGCCTACACTGCCAACCTTGGCCAG
CCCGACGAAGACGATTACAACGCCATTCCCAAAAAAGCAATGGAATACGG
TGCGGAAAACGCCCGCCTGATCGACTGCCGCGCACAACTGGCACACGAAG
GCATCGCCGCCATCCAATGCGGCGCGTTCCACGTTTCCACCGGCGGCATC
GCCTATTTCAACACCACGCCTCTGGGCCGCGCCGTGACCGGCACCATGCT
CGTTTCCGCCATGAAAGAAGACGATGTGAATATCTGGGGCGACGGCAGCA
CCTACAAAGGCAACGACATCGAGCGTTTCTACCGCTACGGCTTGCTCACC
AATCCCGCGCTGAAAATCTACAAACCCTGGCTCGACCAGCAATTTATCGA
CGAACTCGGCGGCCGTCACGAAATGAGCGAATTTCTGATTGCCAACGGCT
TCAACTACAAAATGTCGGTTGAAAAAGCCTACTCCACCGATTCCAATATG
CTCGGCGCGACCCACGAAGCCAAAGACTTGGAATTTTTGAACTCGGGCAT
CAAAATCGTTAAGCCCATCATGGGCGTTGCCTTCTGGGACGAAAACGTCG
AAATTGAACCCGAAGAAGTCAGCGTGCGCTTTGAAGAAGGCGTGCCGGTT
GCATTGAACGGCAAAGAATACGCCGACCCCGTCGAACTCTTCCTCGAAGC
CAACCGCATCGGCGGCCGCCACGGCTTGGGTATGAGCGACCAAATCGAAA
ACCGCATCATCGAAGCCAAATCGCGCGGCATCTACGAAGCCCCGGGCATG
GCATTGTTCCACATCGCCTACGAACGCTTGGTTACCGGCATCCACAACGA
AGACACCATCGAACAATACCGCATCAACGGCCTGCGCCTCGGACGTTTGC
TCTACCAAGGCCGCTGGTTCGACAGCCAAGCCTTGATGTTGCGCGAAACC
GCCCAACGCTGGGTCGCCAAAGCCGTTACCGGCGAAGTTACCCTCGAACT
GCGGCGCGGCAACGACTACTCGATTCTGAACACCGAATCGCCCAACCTGA
CCTACCAACCCGAACGCCTGAGTATGGAAAAAGTCGAAGGTGCGGCGTTC
ACACCGCTCGACCGCATCGGACAGCTCACGATGCGCAACCTCGACATCAC
CGACACCCGCGCCAAACTGGGTATTTATTCGCAAAGCGGTTTGCTCTCGC
TGGGCGAAGGCTCGGTATTGCCGCAGTTGGGCAATAAGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy