Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1597 IGR1590 IGR1594 IGR1598 IGR1593 IGR1588 IGR1591.1 IGR1599 IGR1595 IGR1591 IGR1589 IGR1596 IGR1592 NG1943 NG1938 NG1942 sigG, - NG1944 NG1946 NG1937 NG1941 NG1940 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 purD, - NG1939 NG1943 NG1938 NG1942 sigG, - NG1944 NG1946 NG1937 NG1941 NG1940 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 purD, - NG1939 NG1938 NG1942 sigG, - NG1944 NG1946 NG1945 NG1945 NG1943 NG1937 NG1940 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 purD, - NG1939 NG1941
* Calculated from Protein Sequence

Gene ID: NG1939

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
purD  

Definition:
phosphoribosylamine--glycine ligase

Gene Start:
1915317

Gene Stop:
1916585

Gene Length:
1269

Molecular Weight*:
45166

pI*:
4.80

Net Charge*:
-13.43

EC:
6.3.4.13  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Chopra,A.K., Peterson,J.W. and Prasad,R.
Nucleotide sequence analysis of purH and purD genes from Salmonella typhimurium. Biochim. Biophys. Acta 1090 (3), 351-354 (1991)
Medline: 92062738


Comment:
Oklahoma ID: NGO.1939

For other 'pur' genes, see NG0333 (purC), NG0398 (purA), NG0526 (purM), NG0748 (purE), NG0875 (purK), NG1183 (purL), NG1224 (purN), NG1466 (purH), NG1711 (purB), NG0263 (purF)

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to phosphoribosylamine--glycine ligase sequences. Residues 1-423 are 63% similar to PUR2_SALTY (gb|AAA27198).

Residues 1-423 are virtually identical to NMB2151 in N.meningitidis (gb|AAF42459).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0151
COG name: Phosphoribosylamine-glycine ligase
Functional Class:  F
The phylogenetic pattern of COG0151 is amtkyqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000115 (Phosphoribosylglycinamide synthetase) with a combined E-value of 6.2e-154.
    IPB000115A    2-31
    IPB000115B    63-110
    IPB000115C    141-155
    IPB000115D    211-235
    IPB000115E    253-274
    IPB000115F    280-305
    IPB000115G    329-349
    IPB000115H    402-422


ProDom Summary:  Protein Domain Search
Residues 289-421 are 50% similar to a (LIGASE RIBONUCLEOTIDE GLYCINAMIDE) protein domain (PD002812) which is seen in PUR2_SALTY.

Residues 1-48 are 83% similar to a (LIGASE RIBONUCLEOTIDE GLYCINAMIDE) protein domain (PD002771) which is seen in PUR2_ECOLI.

Residues 61-288 are 70% similar to a (LIGASE SYNTHETASE CARBOXYLASE CARBAMOYL-PHOSPHATE) protein domain (PD000180) which is seen in PUR2_SALTY.



Paralogs:  Local Blast Search


NG1939 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 100 (E-value = 2.2e-58) place NG1939 in the GARS_N family which is described as Phosphoribosylglycinamide synthetase, N domain (PF02844)
Residues 102 to 184 (E-value = 3.2e-42) place NG1939 in the GARS_B family which is described as Phosphoribosylglycinamide synthetase, B domain (PF02842)
Residues 185 to 324 (E-value = 5.1e-88) place NG1939 in the GARS_A family which is described as Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain (PF01071)
Residues 328 to 421 (E-value = 8.3e-46) place NG1939 in the GARS_C family which is described as Phosphoribosylglycinamide synthetase, C domain (PF02843)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
63  
79
transmembrane  
140  
156

PDB Hit:
pdb|1GSO|1GSO-A GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE (GAR-SYN) 526.0 0e+00

Gene Protein Sequence:
MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIESKLQNIALTA
YQDLIEFCRKENIVFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLE
SSKDFAKAFMVKYNIPTAQYQTFENADAAHDYVNQKGAPIVIKADGLVAG
KGVIVAMTLDEAHAAIDDMLLGNKMGNAGERVVIEDFLQGEEASFIVMVD
GNHVLPMATSQDHKRLLDGDKGPNTGGMGAYSPAPVVTPAVYERAMNEII
LPTVAGMKAEGHEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR
LNSDLADLVEAAIDGRLDSVKAEWNPQTAVGVVLAAQNYPETPKKGDVIS
GLDDVNRIGKVFHAGTTVNEKGDVLTNGGRILCVVGLGDDVAQAKAKAYG
ALEKISFDGMQYRKDIADKAINR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACTGCTGGTTATCGGTAATGGCGGTCGCGAACACGCGCTGGCTTG
GAAGTTGGCGCAGTCGCCCAAAGTGGAAACAGTATTTGTTGCGCCCGGTA
ATGCCGGTACGGCGATTGAATCCAAGCTCCAAAACATTGCCTTGACCGCG
TATCAGGATTTGATTGAATTCTGCCGTAAAGAAAATATTGTTTTTACCGT
CGTCGGCCCTGAAGCGCCTTTGGCGGCAGGTATTGTGGATGATTTTCGTG
CCGCAGGGCTGAAAATATTTGGTCCGACACAATATGCGGCGCAGTTGGAA
AGTTCTAAAGATTTCGCCAAAGCATTTATGGTGAAATACAATATTCCGAC
CGCGCAATACCAAACCTTTGAAAATGCCGATGCCGCACATGATTACGTCA
ATCAGAAAGGTGCGCCTATCGTTATCAAAGCCGATGGTTTGGTGGCAGGT
AAAGGCGTGATTGTGGCAATGACTTTGGATGAAGCGCATGCTGCGATTGA
CGATATGTTGTTGGGCAATAAAATGGGCAATGCCGGCGAACGCGTTGTGA
TTGAAGATTTTCTGCAAGGCGAAGAAGCGAGCTTTATCGTTATGGTTGAT
GGCAATCATGTATTGCCTATGGCGACCAGTCAAGACCACAAACGTCTTTT
AGACGGAGATAAAGGCCCGAATACGGGCGGTATGGGTGCGTACAGTCCCG
CGCCTGTGGTAACGCCTGCTGTGTACGAGCGTGCGATGAACGAGATTATT
TTGCCGACCGTAGCGGGTATGAAAGCGGAGGGGCACGAGTTTACCGGCTT
TTTGTACGCAGGTTTGATGATCGATCAAAGCGGTGCACCCTATACGATTG
AGTTTAACTGCCGTTTCGGCGATCCCGAAACCCAGCCGATTATGAGCCGT
CTAAACAGCGATTTGGCGGATTTGGTTGAAGCGGCAATAGACGGCAGACT
GGACAGCGTCAAAGCGGAATGGAATCCGCAAACTGCCGTGGGTGTGGTAC
TGGCGGCGCAAAATTACCCCGAAACACCCAAGAAAGGCGATGTTATTTCC
GGTTTGGATGACGTCAACCGAATCGGCAAAGTATTCCATGCCGGCACAAC
GGTAAACGAGAAAGGCGACGTGTTGACCAACGGCGGGCGCATATTGTGTG
TTGTAGGATTGGGCGACGATGTGGCGCAAGCGAAAGCCAAGGCGTATGGC
GCGTTGGAAAAAATCAGCTTCGACGGGATGCAATACCGTAAAGACATTGC
CGATAAAGCGATTAACCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy