Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1590 IGR1593 IGR1588 IGR1591.1 IGR1586 IGR1591 IGR1589 IGR1592 IGR1585 IGR1587 NG1938 NG1932 mutS, - NG1930 NG1937 NG1940 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 purD, - NG1939 NG1938 NG1932 mutS, - NG1930 NG1937 NG1940 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 purD, - NG1939 NG1938 NG1932 mutS, - NG1930 NG1937 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 purD, - NG1939 NG1940
* Calculated from Protein Sequence

Gene ID: NG1934

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rfaC  

Definition:
lipopolysaccharide heptosyltransferase

Gene Start:
1911229

Gene Stop:
1912194

Gene Length:
966

Molecular Weight*:
36059

pI*:
9.50

Net Charge*:
9.88

EC:
2.4.99.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Blood group glycolipid biosynthesis - neolact series
Lipopolysaccharide biosynthesis
Sphingoglycolipid metabolism

Primary Evidence:
Zhou,D., Lee,N.G. and Apicella,M.A.
Lipooligosaccharide biosynthesis in Neisseria gonorrhoeae: cloning, identification and characterization of the alpha 1,5
heptosyltransferase I gene (rfaC). Mol. Microbiol. 14 (4), 609-618 (1994)
Medline: 95198536


Secondary Evidence:
Chen,L. and Coleman,W.G. Jr.
Cloning and characterization of the Escherichia coli K-12 rfa-2
(rfaC) gene, a gene required for lipopolysaccharide inner core
synthesis
J. Bacteriol. 175 (9), 2534-2540 (1993)
Medline: 93239678

Klena,J.D., Pradel,E. and Schnaitman,C.A.
Comparison of lipopolysaccharide biosynthesis genes rfaK, rfaL,
rfaY, and rfaZ of Escherichia coli K-12 and Salmonella typhimurium
J. Bacteriol. 174 (14), 4746-4752 (1992)
Medline: 92325067



Comment:
Oklahoma ID: NGO.1934

For other 'rfa' genes, see NG0403 (rfaD), NG0987 (rfaF), NG1354 (rfaK), NG0402 (rfaE).

Blast Summary:  PSI-Blast Search
NG1934 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 606855, a predicted lipopolysaccharide heptosyltransferase.

Several matches in gapped BLAST to RfaC proteins. Residues 1-283 are 39% similar to the enzyme from E.coli (gb|AAG58768).

Residues 1-322 are 86% similar to NMB2156 in N.meningitidis (gb|AAF42464).

COGS Summary:  COGS Search
BeTs to 3 clades of COG0859
COG name: ADP-heptose:LPS heptosyltransferase
Functional Class:  M
The phylogenetic pattern of COG0859 is -----Q-cE--HUJ-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002201 (Glycosyltransferase family 9) with a combined E-value of 7.9e-34.
    IPB002201A    12-36
    IPB002201B    240-283


ProDom Summary:  Protein Domain Search
Residues 177-287 are 90% similar to a (TRANSFERASE HEPTOSYLTRANSFERASE PROTEIN) protein domain (PD002299) which is seen in Q50937_NEIGO.

Residues 288-322 are identical to a (TRANSFERASE HEPTOSYLTRANSFERASE I LIPOOLIGOSACCHARIDE) protein domain (PD023975) which is seen in Q50937_NEIGO.

Residues 1-159 are identical to a (TRANSFERASE HEPTOSYLTRANSFERASE I) protein domain (PD006968) which is seen in Q50937_NEIGO.



Paralogs:  Local Blast Search


NG1934 is paralogously related to NG0987 (ADP-heptose--LPS heptosyltransferase II) (4e-07).


Pfam Summary:  Pfam Search
Residues 75 to 318 (E-value = 6.5e-109) place NG1934 in the Glyco_transf_9 family which is described as Glycosyltransferase family 9 (heptosyltransferase) (PF01075)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKILLVRLSSMGDLIHTLPAIEDLARQCSDVELHWLCEAGFAGIARLHPF
VKKVHVMKWRQWRKHLFQAETWREMGRLKQALLQEAFDFVLDSQGLIKSA
CFAKMAKSPIYGLDKHSAREGVAALAYDKKYVVPKGRNAVWRNRDLFAQV
FGYAMPETQVFGLSVPEASRLKNLAQPYYAALHATSRDSKLWPMENWREL
LQKLNQKQQCNVYLPWGNEAEKVRAEQIADGLPFTIVCAKMNLLQAAYLL
KHAVGIVGVDTGLLHLANALEKPVVGIYTDTDPIKTGVQVSAIAKNVGNI
GQIPTADLVYQTLMDCVSADKG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTTTGCTTGTCCGTTTGTCCAGTATGGGTGATTTAATTCACAC
TTTGCCCGCAATCGAAGATTTGGCGCGACAATGCTCTGATGTAGAACTGC
ATTGGCTATGTGAAGCCGGGTTTGCGGGTATTGCACGGTTGCATCCGTTT
GTAAAAAAGGTCCATGTAATGAAGTGGCGGCAATGGCGCAAACATCTCTT
TCAGGCTGAAACTTGGCGGGAGATGGGTCGTCTGAAACAGGCTTTGCTGC
AGGAAGCATTTGATTTTGTATTGGACAGTCAGGGTCTGATTAAAAGCGCG
TGTTTCGCCAAAATGGCAAAATCCCCTATTTATGGTTTGGATAAACACAG
TGCGCGTGAGGGGGTGGCTGCTTTGGCGTATGATAAAAAGTATGTCGTAC
CGAAAGGTAGAAATGCCGTTTGGCGCAACCGTGATCTGTTTGCCCAGGTG
TTTGGGTATGCAATGCCTGAGACGCAGGTATTTGGTTTGTCCGTTCCTGA
AGCAAGCCGTCTGAAAAATTTAGCGCAGCCGTATTATGCGGCTTTGCACG
CGACCAGTCGGGACAGTAAGTTATGGCCTATGGAAAATTGGCGGGAGTTG
CTGCAGAAACTGAATCAAAAACAACAATGCAATGTTTATCTGCCTTGGGG
AAACGAGGCTGAAAAAGTGCGTGCGGAACAGATTGCAGACGGGCTGCCGT
TTACCATAGTGTGCGCTAAAATGAATTTATTACAGGCGGCGTATCTGTTG
AAACACGCGGTTGGAATAGTTGGTGTAGATACCGGTTTGCTGCATTTGGC
AAATGCCTTGGAAAAACCTGTGGTCGGCATTTATACCGATACCGATCCGA
TTAAAACAGGCGTTCAAGTTTCGGCTATTGCAAAAAATGTGGGCAATATC
GGGCAGATTCCGACCGCAGATTTGGTTTATCAAACGCTGATGGATTGTGT
TTCAGCAGATAAAGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy