Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1590 IGR1588 IGR1591.1 IGR1586 IGR1591 IGR1589 IGR1592 IGR1585 IGR1587 NG1938 NG1932 mutS, - NG1930 NG1937 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 purD, - NG1939 NG1938 NG1932 mutS, - NG1930 NG1937 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 purD, - NG1939 NG1938 NG1932 mutS, - NG1930 NG1937 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 purD, - NG1939
* Calculated from Protein Sequence

Gene ID: NG1933

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pncA  

Definition:
pyrazinamidase; nicotinamidase

Gene Start:
1910557

Gene Stop:
1911189

Gene Length:
633

Molecular Weight*:
23424

pI*:
4.90

Net Charge*:
-8.84

EC:
3.5.1.19  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pyridine nucleotides  

Pathway: pathway table
Nicotinate and nicotinamide metabolism

Secondary Evidence:
Frothingham,R., Meeker-O'Connell,W.A., Talbot,E.A., George,J.W. and Kreuzer,K.N.
Identification, cloning, and expression of the Escherichia coli
pyrazinamidase and nicotinamidase gene, pncA.
Antimicrob. Agents Chemother. 40 (6), 1426-1431 (1996)
Medline: 96338362


Comment:
For other 'pnc'genes see NG0962 (pncB).

Oklahoma ID: NGO.1933

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to pyrazinamidase/nicotinamidase sequences. Residues 2-204 are 54% similar to a hypothetical protein in Pseudomonas aeruginosa (gb|AAG08303).

Residues 1-211 are 93% similar to NMA0244, a predicted nicotinamidase in N.meningitidis (AL162752).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1335
COG name: Amidases related to nicotinamidase
Functional Class:  R
The phylogenetic pattern of COG1335 is A--kyqv-EBr-----ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000868 (Isochorismatase hydrolase family) with a combined E-value of 1e-08.
    IPB000868A    4-13
    IPB000868C    124-178


ProDom Summary:  Protein Domain Search
Residues 5-194 are 29% similar to a (PROTEIN HYDROLASE ISOCHORISMATASE) protein domain (PD002453) which is seen in O58727_PYRHO.



Paralogs:  Local Blast Search


NG1933 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1ILW|1ILW-A CRYSTAL STRUCTURE OF 63.2 4e-11
pdb|1YAC|1YAC-A THE 1.8 ANGSTROM CRYSTAL STRUCTURE OF THE YCAC 43.5 3e-05
pdb|1ILW|1ILW-A CRYSTAL STRUCTURE OF 241.0 7e-65
pdb|1YAC|1YAC-A THE

Gene Protein Sequence:
MIVSIDVDAQKTFTPLCPDELPVNEGHLIVEELNAQAALADLRVMTKDAH
HMAAKWLVDNPVDMLKPTGFSDADLTWVAHAMVGTRGYELLDGLPSVKEY
DYCVWKGVDPELHPYGACFHDIEEKLSTGLIEWLRCQNTNMVIVGGLATD
YCVKTTVLQLLKGGRWQVIVNEAACRGIAPDTIEAAWQEMRSSGAIILKN
AEKIKKYINNQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGTTTCCATTGATGTTGATGCACAAAAAACGTTTACGCCACTGTG
TCCTGACGAACTGCCCGTGAACGAGGGGCATTTGATTGTCGAGGAGTTAA
ATGCCCAAGCCGCTTTGGCGGATTTGCGTGTGATGACGAAAGATGCGCAT
CATATGGCGGCGAAATGGCTTGTGGATAACCCTGTTGATATGTTGAAGCC
GACAGGTTTTTCCGATGCGGATTTGACTTGGGTGGCTCATGCGATGGTCG
GTACGCGCGGCTATGAATTGTTGGACGGTCTGCCTTCCGTCAAGGAATAC
GATTATTGCGTTTGGAAAGGTGTCGATCCCGAATTGCATCCTTACGGCGC
GTGTTTTCACGATATTGAGGAAAAACTGAGCACTGGATTGATTGAGTGGC
TGCGTTGTCAAAATACGAATATGGTCATTGTCGGCGGCTTGGCTACGGAT
TATTGTGTTAAAACAACGGTTTTGCAGTTACTTAAAGGCGGTCGTTGGCA
GGTTATCGTGAATGAAGCGGCTTGTCGGGGTATTGCGCCCGATACCATTG
AAGCAGCGTGGCAGGAAATGCGTTCTTCGGGTGCGATAATTTTGAAAAAC
GCCGAAAAAATTAAAAAATATATTAATAATCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy