Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1582 IGR1583 IGR1590 IGR1581 IGR1588 IGR1584 IGR1586 IGR1589 IGR1585 IGR1587 NG1932 mutS, - NG1930 NG1929 NG1927 NG1928 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 gltX, - NG1926 NG1932 mutS, - NG1930 NG1929 NG1927 NG1928 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 gltX, - NG1926 NG1932 mutS, - NG1930 NG1928 pncA, - NG1933 etfB, - NG1935 etfA, - NG1936 rfaC, - NG1934 gapC, - NG1931 gltX, - NG1926 NG1929 NG1927
* Calculated from Protein Sequence

Gene ID: NG1931

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gapC  

Definition:
glyceraldehyde 3-phosphate dehydrogenase C (GapC)

Gene Start:
1908261

Gene Stop:
1909262

Gene Length:
1002

Molecular Weight*:
35748

pI*:
5.50

Net Charge*:
-4.97

EC:
1.2.1.12  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
D-Arginine and D-ornithine metabolism
Glycolysis / Gluconeogenesis

Secondary Evidence:
Flengsrud,R. and Skjeldal,L.
Two-dimensional gel electrophoresis separation and N-terminal
sequence analysis of proteins from Clostridium pasteurianum W5. Electrophoresis 19 (5), 802-806 (1998)
Medline: 98291870


Comment:
For other 'gap'genes see NG1776 (gapB gapA).


Oklahoma ID: NGO.1931

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to glyceraldehyde-3-phosphate dehydrogenase sequences. Residues 4-331 are 74% similar to the enzyme from Clostridium pasteurianum (X72219).

Residues 1-334 are virtually identical to NMB2159 in N.meningitidis (gb|AAF42467).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0057
COG name: Glyceraldehyde-3-phosphate dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0057 is amtkYqvCEBrhUJgpolin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000173 (Glyceraldehyde 3-phosphate dehydrogenase) with a combined E-value of 9.3e-128.
    IPB000173A    4-15
    IPB000173B    89-125
    IPB000173C    145-179
    IPB000173D    184-237
    IPB000173E    247-300
    IPB000173F    306-326


ProDom Summary:  Protein Domain Search
Residues 41-116 are 73% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000255) which is seen in G3P_CLOPA.

Residues 256-331 are 78% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000248) which is seen in G3P_STREQ.

Residues 3-36 are 73% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000269) which is seen in Q9Z5C5_STAAU.

Residues 117-155 are 82% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000250) which is seen in G3P_STRPY.

Residues 156-251 are 82% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD GLYCERALDEHYDE) protein domain (PD000244) which is seen in Q9Z5C5_STAAU.



Paralogs:  Local Blast Search


NG1931 is paralogously related to NG1776 (glyceraldehyde 3-phosphate dehydrogenase) (8e-86).


Pfam Summary:  Pfam Search
Residues 3 to 151 (E-value = 2.6e-89) place NG1931 in the Gp_dh_N family which is described as Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044)
Residues 152 to 313 (E-value = 4e-101) place NG1931 in the Gp_dh_C family which is described as Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain (PF02800)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1HDG|1HDG-O HOLO-D-GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE 352.0 6e-98
pdb|1GD1|1GD1-O $HOLO-*D-*GLYCERALDEHYDE-3-PHOSPHATE 328.0 1e-90
pdb|1DBV|1DBV-O GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE MUTANT 324.0 2e-89
pdb|3DBV|3DBV-O GLYC

Gene Protein Sequence:
MSIKVAINGFGRIGRLALRQIEKAHGIEVAAVNDLTPAEMLLHLFKYDST
QGRFQGTAELKDDAIVVNGREIKVFANPNPEELPWGELGVDVVLECTGFF
TNKTKAEAHIRAGARKVVISAPGGNDVKTVVYGVNQDILDGSETVISAAS
CTTNCLAPMAAVLQKEFGVVEGLMTTIHAYTGDQNTLDAPHRKGDLRRAR
AAALNIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPVATGSLTELVSVLE
RPATKEEINAAMKAASSESYGYNEDQIVSSDVVGIEYGSLFDATQTRVMT
VGGKQLVKTVAWYDNEMSYTCQLVRTLEYFAGKI

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCATCAAAGTAGCGATTAACGGTTTCGGCCGCATCGGCCGCCTCGC
ATTGCGTCAAATTGAAAAAGCCCACGGCATCGAAGTCGCCGCCGTCAACG
ACCTGACCCCTGCCGAAATGCTGCTGCACCTTTTCAAATACGACAGCACA
CAAGGCCGTTTCCAAGGTACTGCCGAATTAAAAGACGATGCCATCGTGGT
AAACGGCAGAGAAATCAAAGTTTTCGCCAATCCGAATCCCGAAGAATTGC
CTTGGGGCGAGTTGGGTGTGGATGTCGTCCTCGAATGTACCGGTTTCTTT
ACCAACAAAACCAAAGCCGAAGCACATATCCGTGCCGGCGCGCGCAAAGT
CGTGATTTCTGCACCCGGCGGCAATGATGTGAAAACCGTCGTATATGGCG
TAAACCAAGACATCTTGGACGGTAGCGAAACTGTCATTTCCGCCGCTTCC
TGTACCACCAACTGCCTTGCCCCGATGGCGGCAGTCCTGCAAAAAGAGTT
CGGCGTAGTCGAAGGCCTGATGACCACCATCCACGCCTACACCGGCGACC
AAAACACCCTTGACGCGCCGCACCGCAAAGGCGATTTGCGCCGCGCCCGC
GCCGCCGCGCTCAACATCGTGCCCAACAGCACCGGCGCCGCCAAAGCCAT
CGGTCTGGTTATCCCCGAATTGAACGGCAAACTCGACGGCTCCGCCCAAC
GCGTCCCTGTTGCCACCGGCTCGCTGACCGAATTGGTTTCCGTCCTCGAA
CGCCCTGCAACCAAAGAAGAAATCAACGCCGCGATGAAAGCCGCCTCCAG
CGAATCTTACGGCTACAACGAAGATCAAATCGTTTCTTCCGACGTTGTCG
GCATCGAATACGGCTCGCTCTTTGACGCAACCCAAACCCGCGTGATGACC
GTGGGCGGCAAACAACTGGTGAAAACCGTTGCCTGGTACGACAACGAAAT
GTCCTACACCTGCCAACTCGTCCGTACTTTGGAATACTTCGCAGGCAAAA
TC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy