Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1582 IGR1583 IGR1581 IGR1576 IGR1577 IGR1580 IGR1579 IGR1584 IGR1578 IGR1585 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 mutS, - NG1930 NG1929 arsC, - NG1924 NG1927 NG1928 NG1925 gapC, - NG1931 pgk, - NG1919 gltX, - NG1926 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 mutS, - NG1930 NG1929 arsC, - NG1924 NG1927 NG1928 NG1925 gapC, - NG1931 pgk, - NG1919 gltX, - NG1926 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 mutS, - NG1930 arsC, - NG1924 NG1928 NG1925 gapC, - NG1931 pgk, - NG1919 gltX, - NG1926 NG1929 NG1927
* Calculated from Protein Sequence

Gene ID: NG1926

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gltX  

Definition:
glutamyl-tRNA synthetase (GltX)

Gene Start:
1902652

Gene Stop:
1904043

Gene Length:
1392

Molecular Weight*:
52318

pI*:
5.70

Net Charge*:
-8.58

EC:
6.1.1.17  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glutamate metabolism
Porphyrin and chlorophyll metabolism

Primary Evidence:
Bernatchez,S., Radia,A. and Dillon,J.R.
Characterization of the cell division gene homologs ftsZ, ftsE and
ftsX in Neisseria gonorrhoeae CH811
Abstracts of the Tenth Pathogenic Neisseria Conference, September 8, 397-398 (1996)

Secondary Evidence:
Brun,Y.V., Sanfacon,H., Breton,R. and Lapointe,J.
Closely spaced and divergent promoters for an aminoacyl-tRNA
synthetase gene and a tRNA operon in Escherichia coli.
Transcriptional and post-transcriptional regulation of gltX, valU
and alaW
J. Mol. Biol. 214 (4), 845-864 (1990)
Medline: 90355200

Breton,R., Sanfacon,H., Papayannopoulos,I., Biemann,K. and
Lapointe,J.
Glutamyl-tRNA synthetase of Escherichia coli. Isolation and primary structure of the gltX gene and homology with other aminoacyl-tRNA synthetases. J. Biol. Chem. 261 (23), 10610-10617 (1986)
Medline: 86278132


Comment:
For other 'glt' genes see NG1525 (gltA) and NG1890 (gltS).

Oklahoma ID: NGO.1926

Blast Summary:  PSI-Blast Search
NG1926 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1684778, a predicted gltX protein.

Several matches in gapped BLAST to Glu-tRNA ligases. Residues 1-462 are 46% similar to SYE_ECOLI (gb|AAA65715).

Residues 1-464 are 95% similar to NMB0003 in N.meningitidis (gb|AAF40482).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0008
COG name: Glutamyl- and glutaminyl-tRNA synthetases
Functional Class:  J
The phylogenetic pattern of COG0008 is amtkYqVcEbrHUJgpolinX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-302 are 55% similar to a (SYNTHETASE GLUTAMYL-TRNA PROTEIN) protein domain (PD001595) which is seen in SYE_ECOLI.

Residues 349-463 are 40% similar to a (SYNTHETASE AMINOACYL-TRNA GLUTAMYL-TRNA) protein domain (PD002794) which is seen in O87076_VIBCH.



Paralogs:  Local Blast Search


NG1926 is paralogously related to NG1611 (glutaminyl-tRNA synthetase) (1e-36) and NG1218 (glutaminyl-tRNA synthetase) (5e-12).


Pfam Summary:  Pfam Search
Residues 2 to 311 (E-value = 5.5e-138) place NG1926 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
81  
124

PDB Hit:
pdb|1G59|1G59-A GLUTAMYL-TRNA SYNTHETASE COMPLEXED WITH 270.0 4e-73
pdb|1QRT|1QRT-A GLUTAMINYL-TRNA SYNTHETASE MUTANT D235G 72.2 2e-13
pdb|1GSG|1GSG-P GLUTAMINYL-T/RNA$ SYNTHETASE (GLN/RS$) COMPLEX 72.2 2e-13
pdb|1QRS|1QRS-A GLUT

Gene Protein Sequence:
MTVKTRFAPSPTGYLHIGGVRTALFSWAFARHHKGEFLLRIEDTDLARST
AESVNIILDGMKWVGLDYDNADNVVYQTRRFDRYKEVIAELLAKGDAYYC
YCSKEELEAMREKAEKEGTATYDRRWRPEAGKTLPEIPAGVQPVVRFKTP
LDGVTKWTDLVKGEISIPNEALDDLIIARADGTPTYNFCAVVDDYDMGVT
HIIRGDDHVNNTPKQINILKAIGANLPEYGHLPMILNEQGKKISKRSGDT
VAITDFGAMGILPEAMLNYLARLGWAHGDDEFFTTEQFIEWFDLKDVSPS
PSRMDLKKLYWINGEHIKITPDGKLTELVKPRLALRDIHETEKPALEDVL
ALVKDRAQDLNALADECLYFYKKQVPAEADVAKHWDDEAAARMLRFAERL
EGLEDWNAKAIHDLFKPFCDEEGIKMGKLGMPLRLAVCGTAKTPSVDAVL
ALISKEKVLKRIRA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGTCAAAACCCGTTTCGCCCCCAGCCCCACCGGTTACCTGCACAT
CGGCGGCGTTCGCACCGCCTTGTTTTCGTGGGCGTTTGCCCGCCATCATA
AAGGCGAATTTTTATTGCGTATCGAAGACACCGACTTGGCACGTTCCACC
GCCGAATCCGTCAACATCATCCTTGACGGCATGAAATGGGTCGGTCTCGA
TTACGACAACGCCGACAACGTGGTGTACCAAACCCGCCGTTTCGACCGTT
ATAAAGAAGTCATTGCCGAACTCTTGGCAAAAGGCGATGCCTACTACTGC
TATTGCAGCAAAGAAGAATTGGAAGCGATGCGCGAGAAAGCCGAAAAAGA
AGGCACGGCGACTTACGACCGCCGCTGGCGGCCGGAAGCAGGCAAAACCC
TGCCCGAAATTCCTGCAGGCGTGCAACCCGTCGTCCGCTTCAAAACGCCT
TTGGACGGCGTTACCAAATGGACAGACTTGGTCAAAGGCGAAATCTCCAT
CCCCAACGAAGCCCTAGACGACCTGATTATTGCCCGCGCCGACGGTACGC
CGACCTACAACTTCTGCGCCGTGGTAGACGACTACGACATGGGCGTTACC
CACATTATCCGCGGGGACGACCATGTGAACAACACCCCGAAACAAATCAA
CATCTTGAAAGCCATCGGCGCGAACCTGCCCGAATACGGGCATCTGCCGA
TGATTCTCAACGAACAAGGCAAAAAAATCTCCAAACGCAGCGGCGATACC
GTCGCCATTACCGATTTCGGCGCAATGGGCATTCTGCCCGAAGCGATGCT
CAACTATTTGGCGCGTTTGGGCTGGGCGCACGGCGACGATGAGTTTTTCA
CGACGGAACAATTCATCGAATGGTTTGATTTGAAAGACGTTTCCCCGTCC
CCAAGCCGTATGGATTTGAAAAAGCTCTATTGGATCAACGGCGAACACAT
CAAAATCACACCCGACGGCAAACTTACCGAACTCGTCAAACCGCGCCTTG
CGCTGCGCGATATTCATGAAACCGAAAAACCTGCGTTGGAAGACGTGTTG
GCACTGGTCAAAGACCGCGCCCAAGATTTGAACGCCTTGGCAGACGAATG
CCTGTATTTCTACAAAAAACAAGTCCCTGCCGAAGCCGATGTTGCCAAAC
ACTGGGACGACGAAGCCGCCGCCCGTATGCTGCGCTTCGCCGAACGCCTC
GAAGGGCTGGAAGACTGGAACGCCAAAGCCATTCACGACCTCTTCAAACC
TTTCTGCGACGAAGAAGGCATCAAAATGGGCAAACTCGGTATGCCCCTGC
GCCTTGCTGTCTGCGGTACGGCAAAAACCCCGAGCGTCGATGCCGTGTTG
GCATTAATCAGCAAAGAGAAAGTGTTGAAACGCATCCGTGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy