Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1573 IGR1572 IGR1576 IGR1575 IGR1577 IGR1580 IGR1579 IGR1578 IGR1574 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 arsC, - NG1924 NG1916 NG1925 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gltX, - NG1926 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 arsC, - NG1924 NG1916 NG1925 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gltX, - NG1926 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 arsC, - NG1924 NG1916 NG1925 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gltX, - NG1926
* Calculated from Protein Sequence

Gene ID: NG1919

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgk  

Definition:
3-phosphoglycerate kinase

Gene Start:
1897580

Gene Stop:
1898770

Gene Length:
1191

Molecular Weight*:
41170

pI*:
5.60

Net Charge*:
-4.91

EC:
2.7.2.3  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Glycolysis / Gluconeogenesis

Primary Evidence:
Bernatchez,S., Radia,A. and Dillon,J.R.
Characterization of the cell division gene homologs ftsZ, ftsE and
ftsX in Neisseria gonorrhoeae CH811
Abstracts of the Tenth Pathogenic Neisseria Conference, September
8, 397-398 (1996)

Secondary Evidence:
Alefounder,P.R. and Perham,R.N.
Identification, molecular cloning and sequence analysis of a gene
cluster encoding the class II fructose 1,6-bisphosphate aldolase,
3-phosphoglycerate kinase and a putative second glyceraldehyde
3-phosphate dehydrogenase of Escherichia coli
Mol. Microbiol. 3 (6), 723-732 (1989)
Medline: 89313302


Comment:
Oklahoma ID: NGO.1919

Blast Summary:  PSI-Blast Search
NG1919 is 98% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1684783, a predicted pgk.

Several matches in gapped BLAST to Pgk proteins. Residues 6-389 are 55% similar to PGKP_ALCEU (gb|AAC43447).

Residues 1-389 are 80% similar to NMB0010 in N.meningitidis (gb|AAF40489).


COGS Summary:  COGS Search
BeTs to 16 clades of COG0126
COG name: 3-phosphoglycerate kinase
Functional Class:  G
The phylogenetic pattern of COG0126 is amtkyqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001576 (Phosphoglycerate kinase family) with a combined E-value of 1.5e-131.
    IPB001576A    10-36
    IPB001576B    54-63
    IPB001576C    105-119
    IPB001576D    135-155
    IPB001576E    164-210
    IPB001576F    249-269
    IPB001576G    290-328
    IPB001576H    343-387


ProDom Summary:  Protein Domain Search
Residues 13-389 are 56% similar to a (KINASE PHOSPHOGLYCERATE TRANSFERASE) protein domain (PD000619) which is seen in PGKP_ALCEU.



Paralogs:  Local Blast Search


NG1919 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 391 (E-value = 1.5e-184) place NG1919 in the PGK family which is described as Phosphoglycerate kinase (PF00162)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
117  
397
transmembrane  
154  
170

PDB Hit:
pdb|1PHP|1PHP 3-PHOSPHOGLYCERATE KINASE (PGK) (E.C.2.7.2.3) 298.0 9e-82
pdb|1VPE|1VPE CRYSTALLOGRAPHIC ANALYSIS OF PHOSPHOGLYCERATE 284.0 2e-77
pdb|3PGK|3PGK PHOSPHOGLYCERATE KINASE (E.C.2.7.2.3) COMPLEX 235.0 9e-63
pdb|1KF0|1KF0-A CRYS

Gene Protein Sequence:
MAFLKLTEQNVRGKTVLIRADMNVPFKGGKISDDTRIRASLASVKYCLDN
GASVIVMTHLGRPTEGEFHPEDDVAPVAAHLGGLLGKDVKVLNDWRENKP
ALNAGDVVMLQNVRINKGEKKNDLELGKAYAALCDVFVNDAFGTAHRAQA
STEAVAQAAPVACAGVLMAGELDALGKALKQPARPMVAIVAGSKVSTKLT
ILESLADKVDQLIVGGGIANTFLLAEGKAIGKSLAEHDLVEESKKIMAKM
AAKGGSVPLPTDVVVAKAFAADAEAVVKDIADVAEDEMILDIGPKSAAAL
ADLLKAAGTVVWNGPVGVFEFDQFAGGTKALAEAIAQSKAFSIAGGGDTL
AAIAKFGVTEQIGYISTGGGAFLEFLEGKELPAVAALEKTRRVNGLI

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATTTTTAAAACTGACCGAACAAAACGTGCGGGGCAAAACCGTCCT
CATCCGCGCCGATATGAACGTGCCGTTCAAAGGCGGCAAAATCAGCGACG
ACACCCGTATCCGCGCCTCGCTCGCGTCCGTCAAATACTGCTTGGACAAC
GGCGCGTCCGTTATTGTGATGACCCACTTGGGCCGCCCGACCGAAGGCGA
GTTCCACCCCGAAGACGACGTTGCGCCCGTTGCCGCGCACTTGGGCGGCC
TGTTGGGCAAAGACGTGAAAGTATTGAACGACTGGCGCGAAAACAAACCG
GCTTTGAACGCGGGCGATGTCGTGATGTTGCAAAACGTGCGTATCAACAA
AGGCGAGAAGAAAAACGATTTAGAACTGGGCAAAGCCTACGCCGCCTTGT
GCGACGTGTTCGTCAATGATGCGTTCGGCACCGCACACCGCGCCCAAGCT
TCGACCGAAGCCGTTGCCCAAGCCGCGCCCGTCGCCTGCGCCGGCGTATT
GATGGCGGGCGAACTCGACGCTTTGGGCAAAGCCCTGAAACAGCCCGCGC
GTCCGATGGTGGCGATTGTTGCCGGCAGCAAAGTGTCCACCAAGCTGACC
ATCCTCGAATCGTTGGCGGACAAAGTCGATCAGCTTATCGTCGGCGGCGG
CATCGCCAACACATTCCTGTTGGCGGAAGGCAAAGCCATCGGTAAATCGC
TGGCGGAACATGATTTGGTGGAAGAATCCAAAAAAATTATGGCGAAAATG
GCGGCCAAAGGCGGTTCTGTGCCGCTGCCGACCGATGTCGTCGTTGCCAA
AGCCTTTGCCGCCGATGCCGAAGCGGTGGTAAAAGACATCGCCGACGTTG
CCGAAGACGAGATGATTTTGGACATCGGCCCGAAATCCGCCGCCGCGCTT
GCCGATTTGCTTAAAGCCGCCGGTACGGTCGTTTGGAACGGGCCGGTCGG
CGTGTTCGAGTTCGATCAATTCGCAGGCGGTACGAAAGCCCTTGCCGAAG
CCATCGCCCAAAGCAAAGCGTTCTCGATTGCGGGCGGCGGCGACACGCTG
GCGGCGATTGCCAAATTCGGCGTTACCGAACAAATCGGCTACATCTCCAC
CGGCGGCGGCGCGTTCCTTGAGTTCTTGGAAGGCAAAGAGCTGCCTGCCG
TAGCCGCTTTGGAAAAAACGCGGCGAGTAAACGGTTTGATA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy