Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1573 IGR1572 IGR1576 IGR1571 IGR1575 IGR1577 IGR1579 IGR1578 IGR1574 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 arsC, - NG1924 NG1916 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 arsC, - NG1924 NG1916 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914 NG1920 tlpA, - NG1923 ftsE, - NG1922 ftsX, - NG1921 arsC, - NG1924 NG1916 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914
* Calculated from Protein Sequence

Gene ID: NG1918

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murA  

Definition:
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (MurA)

Gene Start:
1896246

Gene Stop:
1897496

Gene Length:
1251

Molecular Weight*:
43777

pI*:
5.80

Net Charge*:
-4.90

EC:
2.5.1.7  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Wanke,C., Falchetto,R. and Amrhein,N.
The UDP-N-acetylglucosamine 1-carboxyvinyl-transferase of
Enterobacter cloacae. Molecular cloning, sequencing of the gene and overexpression of the enzyme. FEBS Lett. 301 (3), 271-276 (1992)
Medline: 92249580

Schonbrunn,E., Sack,S., Eschenburg,S., Perrakis,A., Krekel,F.,
Amrhein,N. and Mandelkow,E.
Crystal structure of UDP-N-acetylglucosamine
enolpyruvyltransferase, the target of the antibiotic fosfomycin
Structure 4 (9), 1065-1075 (1996)
Medline: 96398695

Schonbrunn,E., Eschenburg,S., Krekel,F., Luger,K. and Amrhein,N.
Role of the loop containing residue 115 in the induced-fit
mechanism of the bacterial cell wall biosynthetic enzyme MurA
Biochemistry 39 (9), 2164-2173 (2000)
Medline: 20160492


Comment:
Oklahoma ID: NGO.1918

For other 'mur' genes, see NG1500 (murI), NG1532 (murC), NG1533 (murG), NG1535 (murD), NG1539 (murF), NG1541 (murE), NG0394 (murB).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to UDP-N-acetylglucosamine 1-carboxyvinyltransferase sequences. Residues 1-417 are 60% similar to MURA_ENTCL (Z11835).

Residues 1-417 are virtually identical to NMA0258 in N.meningitidis (AL162752).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0766
COG name: UDP-N-acetylglucosamine enolpyruvyl transferase
Functional Class:  M
The phylogenetic pattern of COG0766 is -----qvceBrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 12-389 are 60% similar to a (TRANSFERASE SYNTHASE 1-CARBOXYVINYLTRANSFERASE EPSP) protein domain (PD001867) which is seen in MURA_ACICA.



Paralogs:  Local Blast Search


NG1918 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 405 (E-value = 2.3e-153) place NG1918 in the EPSP_synthase family which is described as EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) (PF00275)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
107  
223
transmembrane  
235  
251

PDB Hit:
pdb|1EJC|1EJC-A CRYSTAL STRUCTURE OF UNLIGANDED MURA (TYPE2) 487.0 0e+00
pdb|1NAW|1NAW-A ENOLPYRUVYL TRANSFERASE 486.0 0e+00
pdb|1UAE|1UAE STRUCTURE OF UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL 483.0 0e+00
pdb|1DLG|1DLG-A CRYS

Gene Protein Sequence:
VDKLKISANGPLNGEITVSGAKNAALPLMCAGLLTSGTLRLKNVPMLADV
ATTQKLLQGMGARVLTDNISEFEINGGTVNNTCAPYELVRTMRASILVLG
PTLARFGEAQVSLPGGCAIGSRPVNQHLKGLEAMGAEIAIEHGYVKAKGK
LKGARVAMDVVTVGGTENLLMAATLAEGTTVLENCAIEPEVVDLAECLVK
MGAKISGIGTSTMIVEGAGELYGCEHSVVPDRIEAGTFLCAVAITGGRVV
LRNAAPKTMEVVLDKLVEAGAVIEAGDDWIAIDMRQRPKAVDIRTVVHPG
FPTDMQAQFMALNAVAEGSCRVVETIFENRFMHVPELNRMGANITTEGNT
AFVQGVERLSGAVVKATDLRASASLVIAGLAARGETVVERIYHLDRGYEN
IEKKLGSVGANIERVSG

Gene Nucleotide Sequence:  Sequence Viewer
GTGGACAAACTGAAAATCTCCGCAAACGGCCCGCTCAACGGGGAAATAAC
GGTCTCGGGCGCGAAAAACGCGGCATTGCCGCTGATGTGCGCGGGTTTGC
TGACGTCGGGTACGTTGCGCCTGAAAAACGTCCCTATGCTGGCAGATGTC
GCAACCACGCAAAAGCTGCTTCAGGGCATGGGCGCGCGCGTTCTGACCGA
CAATATCAGCGAATTTGAAATCAACGGCGGTACGGTCAACAATACCTGCG
CCCCTTACGAATTGGTTCGGACGATGCGCGCTTCGATTTTGGTGCTTGGC
CCGACGCTGGCGCGTTTCGGCGAGGCGCAAGTCAGCCTGCCGGGCGGCTG
CGCCATCGGTTCGCGCCCCGTCAATCAGCATTTGAAAGGCTTGGAAGCGA
TGGGGGCGGAAATCGCCATCGAACACGGTTACGTCAAAGCCAAAGGCAAA
CTCAAAGGTGCGCGCGTGGCGATGGATGTCGTTACCGTCGGCGGTACGGA
AAACCTGCTGATGGCGGCGACGCTGGCGGAAGGTACGACGGTTTTGGAAA
ACTGCGCCATCGAGCCTGAAGTGGTCGATTTGGCGGAATGCCTGGTCAAA
ATGGGCGCGAAAATCAGCGGCATCGGAACATCGACCATGATTGTGGAAGG
TGCGGGCGAGCTGTACGGCTGCGAACACAGCGTCGTCCCCGACCGGATTG
AAGCGGGGACGTTCCTGTGTGCGGTGGCGATAACCGGCGGCAGGGTGGTT
TTGCGGAATGCCGCCCCGAAAACGATGGAAGTGGTGTTGGACAAACTGGT
CGAGGCAGGTGCGGTGATTGAAGCGGGCGACGATTGGATCGCCATCGATA
TGCGGCAGCGTCCGAAGGCGGTGGACATCCGCACGGTCGTCCATCCCGGC
TTCCCCACGGATATGCAGGCGCAGTTTATGGCATTGAATGCCGTGGCAGA
GGGAAGCTGCCGCGTGGTGGAAACGATTTTTGAAAACCGCTTTATGCACG
TTCCGGAGTTGAACCGGATGGGGGCGAACATTACAACCGAGGGCAATACG
GCATTTGTGCAGGGTGTGGAACGGCTTTCCGGCGCGGTCGTCAAGGCGAC
GGATTTGCGCGCGTCCGCCAGCCTCGTTATCGCCGGTTTGGCGGCGCGCG
GCGAAACCGTGGTCGAACGGATTTACCACTTGGATCGCGGTTATGAAAAT
ATTGAAAAAAAACTCGGCAGCGTCGGTGCGAACATCGAGCGCGTATCCGG
C


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy