Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1573 IGR1572 IGR1571 IGR1570 IGR1575 IGR1574 IGR1569.1 pilC, - NG1912 NG1913 NG1916 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914 pilC, - NG1912 NG1913 NG1916 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914 pilC, - NG1912 NG1913 NG1916 NG1917 pgk, - NG1919 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914
* Calculated from Protein Sequence

Gene ID: NG1915

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
kdtA  

Definition:
3-deoxy-D-manno-octulosonic-acid transferase

Gene Start:
1893113

Gene Stop:
1894381

Gene Length:
1269

Molecular Weight*:
47072

pI*:
9.40

Net Charge*:
12.72

EC:
2.-.-.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Secondary Evidence:
Clementz,T.
The gene coding for 3-deoxy-manno-octulosonic acid transferase and
the rfaQ gene are transcribed from divergently arranged promoters
in Escherichia coli. J. Bacteriol. 174 (23), 7750-7756 (1992)
Medline: 93077458


Comment:
For other 'kdt' genes see NG2085 (kdtB).

Oklahoma ID: NGO.1915

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to 3-deoxy-D-manno-octulosonic-acid transferase (KdtA) sequences. Residues 1-371 are 40% similar to the enzyme from P.aeruginosa (gb|AAG08373).

Residues 1-423 are 94% similar to NMB0014 in N.meningitidis (gb|AAF40493).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1519
COG name: 3-Deoxy-D-manno-octulosonic-acid transferase (LPS biosynthesis)
Functional Class:  M
The phylogenetic pattern of COG1519 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 37-372 are 38% similar to a (TRANSFERASE) protein domain (PD004171) which is seen in O52785_ACIHA.



Paralogs:  Local Blast Search


NG1915 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 31 to 218 (E-value = 1.1e-106) place NG1915 in the Glycos_transf_N family which is described as 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase) (PF04413)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
50

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MFQWLYDVLWLLAPIWIRRYLDKRSGSAPAYRAHRDERFGKPHPNPVTGA
VWIHAVSVGETRAAQPLIRELRRRFPDAPLLMTQMTPTGRETAQVLFPDA
QCRYLPYDKKTWVRQFLREHRPMFGILMETEIWPNLMKECRRAGVPLFLA
NARLSEKSLNGYLKVRRLIRPAAASLTGCLAQTEADAARLAKLGAASVQV
CGNTKYDLMPSEDMKTLAGQFEKRIGGRPVAVCGSTRVYRGEDEAEKLLA
AWQQYRGDALLAVVPRHPEHFQTTFETAKRFGFKVQRRSDGLPVEPDTQV
WVGDSMGELYAYYLCADVAFVGGSLVGSGCQNIIEPLSCGVTTIFGFSTY
NFSEACRHALASGAAVQVESADAWREAVEKTLSGEGGGMQMQARVDGFIA
QHRGAGARIAEAVREAVCGHRGR

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCCAATGGCTTTATGATGTATTGTGGCTGCTTGCGCCGATATGGAT
ACGGCGTTATTTGGACAAACGCTCCGGAAGTGCCCCGGCATACCGGGCGC
ATAGGGACGAGCGTTTCGGCAAGCCGCATCCGAATCCCGTTACCGGCGCG
GTTTGGATACACGCCGTTTCGGTCGGAGAAACGCGTGCCGCCCAGCCCTT
GATACGCGAGTTGCGGCGGCGTTTTCCCGATGCGCCGCTGCTGATGACGC
AGATGACCCCGACGGGACGGGAAACCGCGCAAGTTCTGTTTCCCGATGCG
CAATGCCGCTATCTTCCGTATGACAAAAAAACGTGGGTACGGCAGTTTTT
GCGCGAACACCGCCCGATGTTCGGCATTTTGATGGAAACCGAAATCTGGC
CCAATCTGATGAAGGAATGCCGGCGAGCGGGTGTGCCGCTGTTTTTGGCG
AATGCGCGGCTGTCGGAAAAATCGCTGAACGGTTATCTGAAAGTCCGCCG
CCTGATCCGTCCCGCAGCCGCTTCGCTGACGGGCTGTCTGGCGCAGACGG
AGGCGGATGCGGCGCGGTTGGCGAAATTGGGCGCGGCATCCGTGCAGGTG
TGCGGCAATACCAAATACGACCTGATGCCGTCTGAAGACATGAAAACGCT
GGCGGGGCAGTTTGAAAAACGCATCGGAGGCCGGCCGGTTGCCGTGTGCG
GCAGCACGCGCGTTTATCGGGGCGAAGACGAGGCGGAAAAACTGCTGGCG
GCGTGGCAACAATATCGCGGCGATGCCCTGCTGGCCGTCGTGCCGCGCCA
TCCCGAGCATTTTCAGACGACATTTGAAACGGCGAAACGCTTCGGGTTTA
AGGTTCAGCGGCGCAGCGACGGTTTGCCGGTCGAACCCGATACGCAGGTG
TGGGTAGGCGACAGTATGGGCGAGCTGTATGCGTATTACCTGTGCGCCGA
TGTCGCTTTTGTCGGCGGCAGTCTGGTCGGTTCGGGCTGTCAGAACATCA
TCGAACCGCTTTCCTGCGGCGTTACGACGATATTCGGCTTTTCGACCTAC
AATTTTTCCGAAGCCTGCCGGCACGCCTTGGCATCGGGTGCGGCGGTTCA
AGTCGAATCGGCGGACGCGTGGCGTGAAGCCGTTGAAAAAACCTTATCTG
GCGAGGGGGGCGGAATGCAGATGCAGGCGCGCGTGGACGGCTTTATCGCA
CAACATCGCGGAGCGGGCGCGAGAATCGCCGAGGCGGTGCGGGAAGCGGT
ATGCGGACATCGGGGGCGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy