Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1573 IGR1572 IGR1571 IGR1570 IGR1574 IGR1569.1 pilC, - NG1912 NG1913 NG1916 NG1917 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914 pilC, - NG1912 NG1913 NG1916 NG1917 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914 Type: direct, Name:  - 115 pilC, - NG1912 NG1913 NG1916 NG1917 murA, - NG1918 kdtA, - NG1915 gnd, - NG1914
* Calculated from Protein Sequence

Gene ID: NG1914

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gnd  

Definition:
6-phosphogluconate dehydrogenase, decarboxylating (Gnd)

Gene Start:
1891602

Gene Stop:
1893047

Gene Length:
1446

Molecular Weight*:
52701

pI*:
5.10

Net Charge*:
-9.94

EC:
1.1.1.44  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Pentose phosphate cycle

Secondary Evidence:
Yoshida,Y., Nakano,Y., Yamashita,Y. and Koga,T.
The gnd gene encoding a novel 6-phosphogluconate dehydrogenase and
its adjacent region of Actinobacillus actinomycetemcomitans
chromosomal DNA. Biochem. Biophys. Res. Commun. 230 (1), 220-225 (1997)
Medline: 97148607


Comment:
Oklahoma ID: NGO.1914

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to 6-phosphogluconate dehydrogenase. Residues 1-482 are 78% similar to 6PGD_HAEIN (gb|AAC22210).

Residues 1-482 are 93% similar to NMB0015 in N.meningitidis (gb|AAF40494).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0362
COG name: 6-phosphogluconate dehydrogenase, family 1
Functional Class:  G
The phylogenetic pattern of COG0362 is ----Y-vceBrh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001744 (6-phosphogluconate dehydrogenase) with a combined E-value of 3.8e-233.
    IPB001744A    11-37
    IPB001744B    48-85
    IPB001744C    94-145
    IPB001744D    165-200
    IPB001744E    210-241
    IPB001744F    243-287
    IPB001744G    341-394
    IPB001744H    424-454
***** IPB002204 (3-hydroxyisobutyrate dehydrogenase) with a combined E-value of 3.9e-06.
    IPB002204A    5-18
    IPB002204C    123-140
    IPB002204D    174-209


ProDom Summary:  Protein Domain Search
Residues 317-468 are 84% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE) protein domain (PD001549) which is seen in 6PGD_ACTAC.

Residues 4-72 are 82% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE) protein domain (PD001594) which is seen in 6PGD_ACTAC.

Residues 251-314 are 81% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE) protein domain (PD023745) which is seen in 6PGD_HAEIN.

Residues 73-218 are 71% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE OXIDOREDUCTASE PENTOSE) protein domain (PD001025) which is seen in 6PGD_HAEIN.



Paralogs:  Local Blast Search


NG1914 is paralogously related to NG1567 (quinolinate synthetase (NadA)) (0.001).


Pfam Summary:  Pfam Search
Residues 2 to 175 (E-value = 6.2e-122) place NG1914 in the NAD_binding_2 family which is described as NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446)
Residues 177 to 469 (E-value = 6.5e-227) place NG1914 in the 6PGD family which is described as 6-phosphogluconate dehydrogenase, C-terminal domain (PF00393)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
30
transmembrane  
5  
21
non-globular  
220  
283

PDB Hit:
pdb|1PGN|1PGN 6-PHOSPHOGLUCONATE DEHYDROGENASE (6-PGDH) 608.0 0e+00
pdb|1PGJ|1PGJ-A X-RAY STRUCTURE OF 6-PHOSPHOGLUCONATE 263.0 4e-71
pdb|1PGN|1PGN 6-PHOSPHOGLUCONATE DEHYDROGENASE (6-PGDH) 754.0 0.000000
pdb|1PGJ|1PGJ-A X-

Gene Protein Sequence:
MKGDIGVIGLAVMGQNLILNMNDCGFKVVAYNRTIGKVDEFLNGAAKETG
IIGAYSLQDLVDKLAKPRKIMMMVRAGSVVDDFVEQLLPLLEEGDIIIDG
GNANYPDTTRRTHYLAGKGILFVGAGVSGGEEGARRGPSIMPGGDKRAWE
AVKPIFQAIAAKTPQGEPCCDWVGKDGAGHFVKMVHNGIEYGDMQLICEA
YQFMKDGLGLSYDEMHRVFAEWNKTELDSYLIEITAAILGYKDEGGEPLA
EKILDTAGQKGTGKWTGINALDLGIPLTLISEAVFARCVSSFKEQRVQTG
KLFARTATPVEGGKQEWVEALRQALLASKIISYAQGFMLIREAGESYGWG
LDYGNTALLWREGCIIRSAFLGNIRDAYEANPDLVFLGADPYFKNILENC
LPAWRKVVAKAVECGIPMPCMASAITFLDGYTTERLPANLLQAQRDYFGA
HTYERTDKPRGEFFHTNWTGKGGDTASTTYDI

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGGCGATATTGGCGTAATCGGTTTGGCGGTTATGGGGCAAAACCT
GATTTTGAATATGAACGATTGCGGATTTAAGGTTGTCGCCTACAACCGGA
CAATCGGTAAAGTGGACGAATTTTTAAACGGTGCGGCAAAAGAGACGGGC
ATTATCGGCGCGTATTCCCTGCAAGACTTGGTCGATAAGCTGGCAAAACC
GAGAAAAATCATGATGATGGTTCGCGCAGGTTCGGTGGTTGACGACTTTG
TCGAACAACTGCTTCCGCTGTTGGAAGAAGGCGACATCATTATCGACGGC
GGCAATGCCAATTACCCCGACACGACACGGCGGACACATTACCTTGCCGG
AAAAGGGATTTTGTTTGTCGGCGCGGGCGTATCCGGCGGCGAAGAAGGCG
CGCGGCGCGGGCCGTCCATCATGCCGGGCGGGGATAAGCGCGCTTGGGAA
GCGGTCAAGCCGATTTTCCAGGCGATTGCCGCCAAAACGCCGCAGGGCGA
ACCGTGTTGCGACTGGGTCGGCAAGGATGGCGCGGGACATTTTGTCAAAA
TGGTGCACAACGGCATCGAATACGGCGATATGCAGCTGATTTGCGAAGCG
TACCAGTTTATGAAAGACGGTTTGGGGCTGTCCTACGACGAAATGCACCG
CGTGTTTGCCGAGTGGAATAAAACCGAGCTGGATTCTTATCTGATTGAAA
TCACAGCGGCAATTTTGGGCTATAAGGACGAAGGCGGCGAACCGCTGGCC
GAGAAAATCCTCGATACGGCAGGGCAAAAAGGCACGGGCAAATGGACGGG
CATCAATGCCTTGGATTTGGGCATTCCGCTGACGCTGATTTCCGAAGCCG
TATTCGCCCGCTGTGTTTCGTCGTTCAAAGAACAGCGCGTGCAGACCGGC
AAGCTGTTCGCCCGAACCGCCACGCCCGTCGAAGGCGGCAAACAAGAATG
GGTCGAGGCGTTGAGGCAGGCTTTGCTTGCCTCCAAAATCATTTCCTACG
CACAAGGCTTTATGTTGATCCGCGAAGCGGGCGAAAGTTACGGCTGGGGT
TTGGACTACGGCAACACTGCGCTGCTGTGGCGCGAAGGCTGCATCATCCG
CAGCGCGTTTTTGGGCAATATCCGCGACGCGTATGAGGCCAATCCCGATT
TGGTGTTCTTGGGTGCGGATCCGTATTTCAAAAATATTTTGGAAAACTGC
CTGCCGGCATGGCGCAAGGTGGTTGCCAAGGCGGTCGAATGCGGCATCCC
TATGCCCTGCATGGCTTCGGCGATTACGTTCTTGGACGGCTATACGACCG
AACGCCTGCCTGCCAACCTCTTGCAGGCACAGCGCGACTACTTCGGCGCG
CACACTTACGAGCGCACCGACAAACCGCGCGGCGAATTTTTCCATACCAA
CTGGACGGGCAAGGGCGGAGATACCGCTTCGACAACCTACGATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy