Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-5 tRNA-Ile-3 rRNA-16S-4 rRNA-23S-4 IGR1564 IGR1563 IGR1567 IGR1565 IGR1562 IGR1566 IGR1561 NG1906 dskA, - NG1904 NG1907 proC, - NG1905 pilT, - NG1908 pilT, - NG1909 NG1910 NG1906 dskA, - NG1904 NG1907 proC, - NG1905 pilT, - NG1908 pilT, - NG1909 NG1910 Type: direct, Name:  - 107 Type: direct, Name:  - 102 Type: direct, Name:  - 114 Type: direct, Name:  - 104 Type: direct, Name:  - 105 Type: direct, Name:  - 109 Type: direct, Name:  - 123 dskA, - NG1904 NG1907 proC, - NG1905 NG1906 pilT, - NG1908 pilT, - NG1909 NG1910
* Calculated from Protein Sequence

Gene ID: NG1905

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
proC  

Definition:
pyrroline-5-carboxylate reductase (ProC)

Gene Start:
1879946

Gene Stop:
1879158

Gene Length:
789

Molecular Weight*:
28148

pI*:
7.40

Net Charge*:
1.03

EC:
1.5.1.2  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Arginine and proline metabolism
Urea cycle and metabolism of amino groups

Secondary Evidence:
Nakamura,T., Katoh,Y., Shimizu,Y., Matsuba,Y. and Unemoto,T.
Cloning and sequencing of novel genes from Vibrio alginolyticus
that support the growth of K+ uptake-deficient mutant of
Escherichia coli.
Biochim. Biophys. Acta 1277 (3), 201-208 (1996)
Medline: 97137009

Deutch,A.H., Smith,C.J., Rushlow,K.E. and Kretschmer,P.J.
Escherichia coli delta 1-pyrroline-5-carboxylate reductase: gene
sequence, protein overproduction and purification
Nucleic Acids Res. 10 (23), 7701-7714 (1982)
MEDLINE: 83116986


Comment:
For other 'pro' genes see NG0566 (proS) and NG0850 (proA).


Oklahoma ID: NGO.1905c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to pyrroline-5-carboxylate reductase sequences. Residues 26-261 are 35% similar to PROC_PSEAE (gb|AAA25975).

Residues 1-263 are 93% similar to NMA0215 in N.meningitidis (AL162752).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0345
COG name: Pyrroline-5-carboxylate reductase
Functional Class:  E
The phylogenetic pattern of COG0345 is --t-yqvceBrhuj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000304 (Delta 1-pyrroline-5-carboxylate reductase) with a combined E-value of 5.2e-49.
    IPB000304A    3-18
    IPB000304B    57-67
    IPB000304C    106-115
    IPB000304D    154-189
    IPB000304E    213-241


ProDom Summary:  Protein Domain Search
Residues 63-260 are 39% similar to a (REDUCTASE PYRROLINE-5-CARBOXYLATE) protein domain (PD002555) which is seen in PROC_VIBAL.



Paralogs:  Local Blast Search


NG1905 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 243 (E-value = 2e-72) place NG1905 in the P5CR family which is described as Delta 1-pyrroline-5-carboxylate reductase (PF01089)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
14
non-globular  
80  
131
transmembrane  
81  
97

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNVYFLGGGNMAAAVAGGLVKQGGYRIHIANRGAEKRERLGKELGVETSA
TLPELHSDDVLILAVKPQDMEAACKNIRTNGALVLSVAAGLSVGTLSRYL
GGSRRIVRVMPNTPGKIGLGVSGMYAEAEVSETDRRIADRIMKSVGLTVW
LEDEAQMHSITGISGSGPAYVFYLLDALQNAAIRQGFDMAEARALSLATF
KGAVALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRVAEAISEGVCA
CVCRSQEMERQYQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGTTTATTTTCTCGGCGGCGGAAATATGGCGGCTGCCGTTGCGGG
CGGATTGGTCAAACAAGGGGGATACCGCATCCATATAGCCAACCGTGGTG
CGGAAAAGCGCGAACGTTTGGGAAAAGAGTTGGGGGTCGAAACTTCGGCA
ACCCTGCCGGAGCTTCATTCCGACGATGTTTTAATCCTTGCCGTCAAACC
GCAGGATATGGAAGCCGCGTGCAAAAATATCCGCACCAACGGCGCATTGG
TGCTTTCTGTCGCAGCCGGATTGTCGGTCGGTACGCTCAGCCGTTACCTC
GGGGGAAGCCGCCGCATTGTCCGGGTTATGCCGAATACACCCGGAAAAAT
CGGGCTGGGCGTATCCGGTATGTATGCCGAAGCGGAAGTATCGGAAACAG
ACCGCAGGATTGCCGATCGAATCATGAAATCAGTCGGTTTGACCGTTTGG
TTGGAAGATGAAGCGCAAATGCACAGCATTACCGGCATCAGCGGCAGCGG
GCCGGCTTATGTGTTTTATCTGCTGGACGCATTGCAAAATGCCGCCATCC
GACAAGGGTTTGATATGGCAGAAGCACGCGCGCTCAGTCTGGCAACGTTT
AAAGGAGCGGTTGCCCTTGCCGAGCAGACGGGTGAAGATTTCGAGAAGCT
TCAAAAAAATGTAACGTCAAAAGGCGGGACAACCCACGAAGCCGTGGAAG
CCTTCAGACGGCATCGTGTCGCCGAAGCCATAAGTGAGGGCGTTTGTGCC
TGTGTGTGCCGTTCGCAGGAAATGGAACGGCAATATCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy