Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1556 IGR1555 IGR1558.1 IGR1557 IGR1560 IGR1558 IGR1559 dnaJ, - NG1901 NG1900 NG1895 NG1901.1 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897 dnaJ, - NG1901 NG1900 NG1895 NG1901.1 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897 Type: inverse, Name:  - 172 dnaJ, - NG1901 NG1900 NG1895 NG1901.1 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897
* Calculated from Protein Sequence

Gene ID: NG1898

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rfbA  

Definition:
glucose-1-phosphate thymidylyltransferase

Gene Start:
1866307

Gene Stop:
1867170

Gene Length:
864

Molecular Weight*:
31994

pI*:
5.80

Net Charge*:
-3.12

EC:
2.7.7.24  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Purines, pyrimidines, nucleosides, and nucleotides; Sugar-nucleotide biosynthesis and conversions  

Pathway: pathway table
Erythromycin biosynthesis
Nucleotide sugars metabolism

Primary Evidence:
Petering,H., Hammerschmidt,S., Frosch,M., van Putten,J.P.,
Ison,C.A. and Robertson,B.D.
Genes associated with meningococcal capsule complex are also found
in Neisseria gonorrhoeae
J. Bacteriol. 178 (11), 3342-3345 (1996)
Medline: 96236055

Robertson,B.D., Frosch,M. and van Putten,J.P.
The identification of cryptic rhamnose biosynthesis genes in
Neisseria gonorrhoeae and their relationship to lipopolysaccharide
biosynthesis
J. Bacteriol. 176 (22), 6915-6920 (1994)
Medline: 95050260



Secondary Evidence:
Zhang,L., al-Hendy,A., Toivanen,P. and Skurnik,M.
Genetic organization and sequence of the rfb gene cluster of
Yersinia enterocolitica serotype O:3: similarities to the
dTDP-L-rhamnose biosynthesis pathway of Salmonella and to the
bacterial polysaccharide transport systems
Mol. Microbiol. 9 (2), 309-321 (1993)
Medline: 94018626


Comment:
For other 'rfb' genes see NG0332 (rfbD)and NG1897 (rfbB).

Oklahoma ID: NGO.1898

Blast Summary:  PSI-Blast Search
NG1898 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 520897, a predicted glucose-1-phosphate thymid transferase.

Numerous significant hits in gapped BLAST; e.g. residues 1-286 are 72% similar to gb|AAC76794.1| (AE000455) glucose-1-phosphate thymidylyltransferase of Escherichia coli K12.

Residues 1-288 are 91% similar to gb|AAA63158.1| (L09188) TDP-deoxyglucose-epimerase of Neisseria meningitidis.




COGS Summary:  COGS Search
BeTs to 8 clades of COG1209
COG name: dTDP-glucose pyrophosphorylase
Functional Class:  M
The phylogenetic pattern of COG1209 is a-tk--vcEbr----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-124 are identical to a (TRANSFERASE PYROPHOSPHORYLASE PROTEIN BIOSYNTHESIS) protein domain (PD000318) which is seen in RFBA_NEIGO.

Residues 248-287 are 95% similar to a (TRANSFERASE GLUCOSE-1-PHOSPHATE) protein domain (PD002767) which is seen in Q51149_NEIME.

Residues 1-51 are 52% similar to a (PUTATIVE TRANSLATION INITIATION FACTOR) protein domain (PD210496) which is seen in E2BG_CAEEL.

Residues 134-246 are identical to a (TRANSFERASE PYROPHOSPHORYLASE NUCLEOTIDYLTRANSFERASE) protein domain (PD000406) which is seen in RFBA_NEIGO.



Paralogs:  Local Blast Search


NG1898 is paralogously related to NG0060 (sugar-phosphate nucleotidyl transferase (mannose-1-phosphate guanyltransferase-related)) (4e-10) and NG0220 (UTP--glucose-1-phosphate uridylyltransferase) (9e-10).


Pfam Summary:  Pfam Search
Residues 2 to 240 (E-value = 9.4e-114) place NG1898 in the NTP_transferase family which is described as Nucleotidyl transferase (PF00483)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
38  
54

PDB Hit:
pdb|1MC3|1MC3-A CRYSTAL STRUCTURE OF RFFH 439.0 0e+00
pdb|1H5S|1H5S-C THYMIDYLYLTRANSFERASE COMPLEXED WITH TMP 388.0 0e+00
pdb|1H5S|1H5S-B THYMIDYLYLTRANSFERASE COMPLEXED WITH TMP 388.0 0e+00
pdb|1H5R|1H5R-A THYM

Gene Protein Sequence:
MKGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDIL
VITAPEDNAAFQRLLGDGSDFGIRLQYAVQPSPDGLAQAFIIGEEFIGNG
NVCLILGDNIFYGQSFTQTLKQAAAKTHGATVFGYRVKDPERFGVVEFDE
NFNALSIEEKPQQPKSDWAVTGLYFHDNRAVEFAKQLKPSARGELEISDL
NRMYLEDGSLSVQILGRGFAWLDTGTQESLHEAASFVQTVQNIQNLHIAC
LEEIAWRNGWLTKKDVETRAKPLEKTAYGQYLLRLIGK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGGCATCATACTGGCAGGCGGCAGCGGTACGCGCCTATATCCGAT
TACGCGCGGCGTATCCAAACAACTGCTGCCCGTGTACGACAAACCGATGA
TTTATTACCCCTTGTCGGTTTTGATGCTGGCGGGAATCCGCGATATTTTG
GTAATTACCGCACCCGAAGACAACGCTGCCTTCCAACGGCTACTCGGCGA
CGGCTCCGACTTCGGCATCCGCCTGCAATATGCCGTTCAACCCAGCCCCG
ACGGCTTGGCGCAGGCATTTATCATCGGCGAAGAATTTATCGGCAACGGC
AATGTCTGCCTGATTTTGGGCGACAATATTTTCTACGGTCAATCATTTAC
GCAAACATTGAAACAGGCCGCCGCCAAGACCCACGGCGCAACCGTATTCG
GTTATCGGGTTAAAGACCCCGAGCGTTTCGGCGTGGTTGAATTTGACGAA
AACTTCAACGCCTTATCCATCGAAGAGAAACCGCAACAGCCCAAATCCGA
TTGGGCGGTAACCGGCTTGTACTTCCACGACAACCGCGCCGTCGAGTTCG
CCAAACAGCTCAAACCGTCCGCACGCGGCGAATTGGAAATTTCCGACCTC
AACCGGATGTATCTGGAAGACGGCTCGCTGTCCGTTCAAATATTGGGACG
CGGTTTCGCGTGGTTGGACACCGGCACGCAAGAAAGCCTGCACGAGGCGG
CTTCCTTCGTCCAAACCGTGCAAAATATCCAAAACCTGCACATCGCCTGC
CTCGAAGAAATCGCCTGGCGTAACGGCTGGCTGACGAAAAAAGATGTGGA
AACACGGGCAAAGCCTTTGGAAAAAACCGCCTACGGGCAATACCTGCTGC
GCCTGATCGGCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy