Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1556 IGR1555 IGR1558.1 IGR1557 IGR1558 IGR1559 damH,hpyIM, - NG1893 dnaJ, - NG1901 NG1900 NG1895 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897 damH,hpyIM, - NG1893 dnaJ, - NG1901 NG1900 NG1895 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897 dnaJ, - NG1901 NG1900 NG1895 dcmH, - NG1894 damH,hpyIM, - NG1893 dcmH, - NG1894 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897
* Calculated from Protein Sequence

Gene ID: NG1897

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rfbD  rmlB  

Definition:
dTDP-glucose 4,6-dehydratase

Gene Start:
1865162

Gene Stop:
1866199

Gene Length:
1038

Molecular Weight*:
38771

pI*:
6.00

Net Charge*:
-5.71

EC:
4.2.1.46  4.2.1.47  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Purines, pyrimidines, nucleosides, and nucleotides; Sugar-nucleotide biosynthesis and conversions  

Pathway: pathway table
Erythromycin biosynthesis
Fructose and mannose metabolism
Nucleotide sugars metabolism

Primary Evidence:
Petering,H., Hammerschmidt,S., Frosch,M., van Putten,J.P., Ison,C.A. and Robertson,B.D.
Genes associated with meningococcal capsule complex are also found in Neisseria gonorrhoeae.
J. Bacteriol. 178 (11): 3342-3345 (1996)
[Medline: 96236055].

Robertson BD, Frosch M, van Putten JP.
The identification of cryptic rhamnose biosynthesis genes in Neisseria gonorrhoeae and their relationship to lipopolysaccharide
biosynthesis.
J Bacteriol. 1994 Nov;176(22):6915-20.
PMID: 7961452

Secondary Evidence:
Marolda,C.L. and Valvano,M.A.
Genetic analysis of the dTDP-rhamnose biosynthesis region of the
Escherichia coli VW187 (O7:K1) rfb gene cluster: identification of
functional homologs of rfbB and rfbA in the rff cluster and correct location of the rffE gene
J. Bacteriol. 177 (19), 5539-5546 (1995)
Medline: 96032389


Comment:
For other 'rfb' genes see NG0332 (rfbD)and NG1898 (rfbA).



Oklahoma ID: NGO.1897

Blast Summary:  PSI-Blast Search
NG1897 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 520896, a prediced dTDP-D-glucose 4,6-dehydratase.

Numerous significant hits in gapped BLAST; e.g. residues 7-344 are 70% similar to 13364196 (AP002566) dTDP-glucose 4,6-dehydratase Escherichia coli O157:H7.

Residues 1-345 are 88% similar to gb|AAA63157.1| (L09188) TDP-glucose-dehydratase of Neisseria meningitidis.




COGS Summary:  COGS Search
BeTs to 7 clades of COG1088
COG name: dTDP-D-glucose 4,6-dehydratase
Functional Class:  M
The phylogenetic pattern of COG1088 is a-tk---cEbrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001509 (NAD dependent epimerase/dehydratase family) with a combined E-value of 1.9e-40.
    IPB001509A    9-30
    IPB001509B    81-115
    IPB001509C    193-199
    IPB001509D    229-236
    IPB001509E    326-336
    IPB001509E    310-320
***** IPB000558 (Histone H2B) with a combined E-value of 6.3e-12.
    IPB000558    88-132
***** IPB002225 (3-Beta hydroxysteroid dehydrogenase/isomerase family) with a combined E-value of 1.4e-08.
    IPB002225A    6-36
    IPB002225D    299-343


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1897 is paralogously related to NG1896 (UDPglucose 4-epimerase) (4e-13), NG0403 (ADP-L-glycero-D-mannoheptose epimerase) (2e-06), NG0332 (dTDP-4-dehydrorhamnose reductase (dTDP-L-rhamnose synthase) (dTDP-6-deoxy-L-mannose-dehydrogenase) (dTDP-4-keto-L-rhamnose reductase)) (5e-06) and NG0083 (pilin glycosylation protein (possible epimerase-dehydratase)) (4e-04).


Pfam Summary:  Pfam Search
Residues 7 to 340 (E-value = 8.2e-08) place NG1897 in the 3Beta_HSD family which is described as 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073)
Residues 9 to 340 (E-value = 5.4e-214) place NG1897 in the Epimerase family which is described as NAD dependent epimerase/dehydratase family (PF01370)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
23

PDB Hit:
pdb|1BXK|1BXK-A DTDP-GLUCOSE 4,6-DEHYDRATASE FROM E. COLI 496.0 0e+00
pdb|1G1A|1G1A-A THE CRYSTAL STRUCTURE OF DTDP-D-GLUCOSE 472.0 0e+00
pdb|1KEP|1KEP-A THE CRYSTAL STRUCTURE OF DTDP-D-GLUCOSE 261.0 1e-70
pdb|1KVS|1KVS UDP-G

Gene Protein Sequence:
MQTAGKKNILVTGGAGFIGSAVVRHIIQNTRDSVVNLDKLTYAGNLESLT
DIADNPRYAFEQVDICDRAELDRVFAQYRPDAVMHLAAESHVDRAIGSAG
EFIRTNIVGTFDLLEAARAYWQQMPSEKREAFRFHHISTDEVYGDLHGTD
DLFTETTPYAPSSPYSASKAAADHLVRAWQRTYRLPSIVSNCSNNYGPRQ
FPEKLIPLMILNALSGKPLPVYGDGAQIRDWLFVEDHARALYQVVTEGVV
GETYNIGGHNEKTNLEVIKTICALLEELAPEKPAGVARYEDLITFVQDRP
GHDARYAVDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTRRQNA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACCGCAGGCAAAAAAAACATCCTCGTTACCGGCGGCGCGGGTTT
TATCGGCTCGGCAGTCGTCCGCCATATTATCCAAAACACCCGAGATTCCG
TCGTCAACCTCGACAAGTTAACCTACGCGGGCAATCTCGAATCGCTGACC
GACATTGCCGATAATCCCCGCTACGCTTTTGAGCAAGTGGATATTTGCGA
CCGCGCCGAACTCGACCGCGTGTTCGCGCAATACCGGCCCGATGCCGTGA
TGCACTTGGCGGCGGAAAGCCACGTCGACCGCGCCATCGGTTCGGCAGGC
GAATTTATCCGAACCAATATCGTCGGCACATTCGACCTGCTGGAAGCTGC
GCGCGCCTATTGGCAGCAAATGCCGTCTGAAAAACGCGAAGCCTTCCGTT
TCCACCATATTTCTACCGATGAAGTCTATGGCGATTTGCACGGCACAGAC
GATTTGTTTACAGAAACCACGCCATACGCGCCGTCCAGCCCCTACTCCGC
CTCCAAAGCCGCCGCCGACCACCTTGTCCGCGCGTGGCAGCGGACTTACA
GGCTGCCCTCCATTGTCAGCAACTGTTCCAATAATTACGGCCCCCGACAA
TTCCCCGAAAAACTCATTCCTTTGATGATTCTGAACGCACTTTCCGGCAA
ACCACTGCCTGTGTACGGCGACGGGGCGCAAATCCGCGACTGGCTGTTTG
TCGAAGACCACGCGCGCGCGCTGTATCAGGTCGTTACCGAAGGTGTTGTC
GGCGAAACCTACAATATCGGCGGACACAATGAAAAAACCAATCTCGAAGT
GATCAAAACCATCTGCGCCCTCTTGGAAGAACTCGCCCCCGAAAAACCGG
CCGGCGTGGCACGGTATGAAGATTTAATTACTTTCGTACAAGACCGCCCC
GGCCATGATGCCCGCTACGCCGTCGATGCGGCGAAAATCAGGCGGGATTT
GGGCTGGCTGCCTTTGGAAACTTTTGAATCCGGCCTCCGCAAAACCGTGC
AATGGTATTTGGACAACAAAACCCGGCGGCAAAACGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy