Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1556 IGR1555 IGR1558.1 IGR1557 IGR1558 IGR1554.1 damH,hpyIM, - NG1893 NG1900 NG1895 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897 damH,hpyIM, - NG1893 NG1900 NG1895 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897 damH,hpyIM, - NG1893 NG1900 NG1895 dcmH, - NG1894 dcmH, - NG1894 rfbC, - NG1899 rfbA, - NG1898 galE, - NG1896 rfbD,rmlB, - NG1897
* Calculated from Protein Sequence

Gene ID: NG1896

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
galE  

Definition:
UDPglucose 4-epimerase

Gene Start:
1864145

Gene Stop:
1865158

Gene Length:
1014

Molecular Weight*:
36872

pI*:
6.80

Net Charge*:
-1.01

EC:
5.1.3.2  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Energy metabolism; Sugars  

Pathway: pathway table
Galactose metabolism
Nucleotide sugars metabolism

Primary Evidence:
Petering,H., Hammerschmidt,S., Frosch,M., van Putten,J.P., Ison,C.A. and Robertson,B.D. Genes associated
with meningococcal capsule complex are also found in Neisseria gonorrhoeae.
J. Bacteriol. 178 (11): 3342-3345 (1996)
[Medline: 96236055].

Hammerschmidt,S., Birkholz,C., Zahringer,U., Robertson,B.D., van
Putten,J., Ebeling,O. and Frosch,M.
Contribution of genes from the capsule gene complex (cps) to
lipooligosaccharide biosynthesis and serum resistance in Neisseria
meningitidis
Mol. Microbiol. 11 (5), 885-896 (1994)
Medline: 94293762


Robertson,B.D., Frosch,M. and van Putten,J.P.
The role of galE in the biosynthesis and function of gonococcal
lipopolysaccharide
Mol. Microbiol. 8 (5), 891-901 (1993)
Medline: 93360819


Secondary Evidence:
Maskell,D.J., Szabo,M.J., Butler,P.D., Williams,A.E. and Moxon,E.R.
Molecular analysis of a complex locus from Haemophilus influenzae
involved in phase-variable lipopolysaccharide biosynthesis
Mol. Microbiol. 5 (5), 1013-1022 (1991)
Medline: 92065797


Comment:
For other 'gal' genes see NG0220 (galU).

Oklahoma ID: NGO.1896

Blast Summary:  PSI-Blast Search
NG1896 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1051296, a predicted UDP-glucose 4-epimerase.

Numerous significant hits in gapped BLAST; e.g. residues 1-338 are 58% similar to 43589 (X57315) UDP-galactose-4-epimerase of Haemophilus influenzae.

Residues 3-338 are 81% similar to gb|AAA63156.1| (L09188) UPD-glucose-4-epimerase of Neisseria meningitidis.




COGS Summary:  COGS Search
BeTs to 8 clades of COG1087
COG name: UDP-glucose 4-epimerase
Functional Class:  M
The phylogenetic pattern of COG1087 is --t-yq-Ceb-hujgp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001509 (NAD dependent epimerase/dehydratase family) with a combined E-value of 6.1e-33.
    IPB001509A    3-24
    IPB001509B    75-109
    IPB001509C    197-203
    IPB001509D    231-238
    IPB001509E    303-313
***** IPB002225 (3-Beta hydroxysteroid dehydrogenase/isomerase family) with a combined E-value of 1.6e-06.
    IPB002225A    0-30
    IPB002225B    123-177
    IPB002225C    227-269


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1896 is paralogously related to NG1897 (dTDP-glucose 4,6-dehydratase) (4e-13), NG0403 (ADP-L-glycero-D-mannoheptose epimerase) (2e-12) and NG0083 (pilin glycosylation protein (possible epimerase-dehydratase)) (2e-05).


Pfam Summary:  Pfam Search
Residues 3 to 333 (E-value = 9e-146) place NG1896 in the Epimerase family which is described as NAD dependent epimerase/dehydratase family (PF01370)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1UDC|1UDC STRUCTURE OF UDP-GALACTOSE-4-EPIMERASE COMPLEXED 387.0 0e+00
pdb|1LRK|1LRK-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI 387.0 0e+00
pdb|1LRJ|1LRJ-A CRYSTAL STRUCTURE OF E. COLI UDP-GALACTOSE 387.0 0e+00
pdb|1KVR|1KVR UDP-G

Gene Protein Sequence:
MTVLITGGTGFIGSHTAVSLVQSGYDAVILDNLCNSSAAVLPRLRQITGR
NIPFYQGDIRDCQILRQIFSEHEIESVIHFAGLKAVGESVAEPTKYYGNN
VYGSLVLAEEMARAGVLKIVFSSSATVYGDAEKVPYTEDMRPGDTANPYG
ASKAMVERMLTDIQKADPRWSVILLRYFNPIGAHESGLIGEQPNGVPNNL
LPYICQVASGRLPQLSVFGGDYPTPDGTGMRDYIHVMDLAEGHIAAMKAK
GGVAGVHLFNLGSGRAYSVLEIIRAFEAASGLHIPYRIQPRRAGDLACSY
ADPSHTKQQTGWETKRGLQQMMEDSWRWVSRNPGRYGD

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGTCCTGATTACCGGCGGCACCGGCTTTATCGGTTCGCACACCGC
CGTCTCGCTCGTCCAATCCGGTTACGATGCCGTGATTTTGGATAATCTGT
GCAACTCGTCTGCCGCCGTCCTCCCGCGCCTTCGGCAAATTACCGGCAGA
AACATACCGTTTTATCAGGGCGACATCCGCGACTGTCAGATTTTGAGGCA
GATTTTTTCAGAACATGAAATCGAATCCGTCATCCATTTTGCCGGTTTGA
AGGCAGTGGGGGAAAGCGTTGCCGAGCCGACAAAATATTACGGCAACAAT
GTTTACGGCAGCCTGGTGCTGGCGGAAGAAATGGCGCGCGCGGGCGTGTT
GAAAATCGTATTCAGCTCGTCGGCAACCGTTTACGGCGATGCGGAAAAAG
TCCCCTATACGGAAGATATGCGCCCGGGCGATACCGCTAATCCTTACGGT
GCGTCCAAAGCGATGGTGGAGCGGATGTTGACCGACATCCAAAAAGCCGA
TCCGCGTTGGAGCGTGATTTTGTTGCGCTATTTCAACCCGATCGGCGCGC
ACGAAAGCGGACTTATCGGCGAACAGCCCAACGGCGTTCCCAACAATCTT
TTGCCCTATATCTGTCAAGTGGCTTCGGGCAGGCTGCCGCAACTGTCGGT
ATTCGGCGGCGACTATCCGACCCCCGACGGTACGGGAATGCGCGACTACA
TCCATGTGATGGATTTGGCAGAAGGGCATATCGCGGCAATGAAGGCGAAA
GGCGGCGTTGCCGGCGTACATTTGTTCAACTTGGGTTCGGGACGCGCCTA
TTCCGTTTTGGAAATCATCCGCGCCTTTGAGGCCGCATCCGGTTTGCACA
TTCCTTACCGAATCCAACCCCGCCGCGCCGGCGACTTGGCGTGTTCCTAT
GCCGACCCGTCCCATACCAAACAACAAACCGGCTGGGAAACCAAACGCGG
CTTGCAGCAAATGATGGAAGATTCGTGGCGTTGGGTCAGCCGCAACCCCG
GCAGATATGGGGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy