Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1556 IGR1551 IGR1550 IGR1554 IGR1555 IGR1552 IGR1549 IGR1553 IGR1554.1 NG1887 NG1888 NG1891 dcrH, - NG1892 damH,hpyIM, - NG1893 NG1889 gltS, - NG1890 NG1895 galE, - NG1896 rfbD,rmlB, - NG1897 NG1887 NG1888 NG1891 dcrH, - NG1892 damH,hpyIM, - NG1893 NG1889 gltS, - NG1890 NG1895 galE, - NG1896 rfbD,rmlB, - NG1897 NG1888 NG1891 dcrH, - NG1892 damH,hpyIM, - NG1893 NG1889 gltS, - NG1890 NG1895 dcmH, - NG1894 dcmH, - NG1894 NG1887 rfbD,rmlB, - NG1897 galE, - NG1896
* Calculated from Protein Sequence

Gene ID: NG1893

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
damH  hpyIM  

Definition:
N6-methyladenine methyltransferase

Gene Start:
1860728

Gene Stop:
1859724

Gene Length:
1005

Molecular Weight*:
39464

pI*:
9.50

Net Charge*:
8.51

EC:
2.1.1.72  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Gunn,J.S.and Stein,D.C.
The Neisseria gonorrhoeae S.NgoVIIIrestriction/modification system:a typeIIs system homologous to the Haemophilus parahaemolyticus HphI restriction/modification system
Nucleic Acids Res.25(20),4147-4152(1997)
Medline: 97465963

Petering,H.,Hammerschmidt,S.,Frosch,M.,van Putten,J.P.,
Ison,C.A. and Robertson,B.D.
Genes associated with meningococcal capsule complex are also found in Neisseria gonorrhoeae
J. Bacteriol.178(11),3342-3345(1996)
Medline: 96236055



Secondary Evidence:
Xu,Q., Peek,R.M. Jr., Miller,G.G. and Blaser,M.J.
The Helicobacter pylori genome is modified at CATG by the product
of hpyIM
J.Bacteriol.179(21),6807-6815(1997)
Medline: 98012982

Que,Q.,Zhang,Y.,Nelson,M.,Ropp,S.,Burbank,D.E.and Van Etten,J.L.
Chlorella virus SC-1A encodes at least five functional and one
nonfunctional DNA methyltransferases
Gene 190(2),237-244(1997)
Medline: 97341065

Looney,M.C.,Moran,L.S.,Jack,W.E.,Feehery,G.R.,Benner,J.S.,Slatko,
B.E.and Wilson,G.G.
Nucleotide sequence of the FokI restriction-modification system:
separate strand-specificity domains in the methyltransferase
Gene 80(2),193-208(1989)
Medline: 90060769

Looney,M.C., Moran,L.S., Jack,W.E., Feehery,G.R., Benner,J.S.,
Slatko,B.E. and Wilson,G.G.
Nucleotide sequence of the FokI restriction-modification system:
separate strand-specificity domains in the methyltransferase
Gene 80 (2), 193-208 (1989)
Medline: 90060769


Comment:
For other 'dcm' genes see NG0365 (dcmG), NG0873 (dcmD) ,NG1795
(dcmH) and NG1991 (dcm).


Oklahoma ID: NGO.1893c

Blast Summary:  PSI-Blast Search
NG1893 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 2330912, a predicted N6-methyladenine methyltransferase.

Numerous hits in gapped BLAST to methyltransferase sequences,e.g. residues 1-114 are 97% similar to orf of Neisseria meningitidis (gb|AAC37048.1|).Residues 2-334 are 73% similar to site-specific DNA-methyltransferase (adenine-specific) of Haemophilus parahaemolyticus (emb|CAA59691.1|).Residues 8-335 are 22% similar to NlaIII methyltransferase (adenine-specific DNA-methyltransferase)of Neisseria lactamica (emb|CAA38356.1| ).
Residues 8-326 are 23% similar to ulcer associated adenine specific DNA methyltransferase of Helicobacter pylori 26695 (gb|AAD08252.1|).



COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** PR00505 (D12 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 7.1e-21.
    PR00505A    10-26
    PR00505B    32-46
    PR00505C    53-66
    PR00505D    217-229


ProDom Summary:  Protein Domain Search
Residues 201-328 are identical to a (METHYLTRANSFERASE TRANSFERASE METHYLASE) protein domain (PD004633) which is seen in O30358_NEIGO.

Residues 116-194 are identical to a (METHYLTRANSFERASE TRANSFERASE MODIFICATION METHYLASE) protein domain (PD037133) which is seen in O30358_NEIGO.

Residues 1-114 are identical to a (METHYLTRANSFERASE TRANSFERASE METHYLASE) protein domain (PD004050) which is seen in O30358_NEIGO.



Paralogs:  Local Blast Search


NG1893 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 297 (E-value = 1.2e-89) place NG1893 in the MethyltransfD12 family which is described as D12 class N6 adenine-specific DNA methyltransferase (PF02086)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNKKYPKINYIGNKEKIASWICDQLPSDVDTVADVFSGGCSFAYEAKKRG
YRVITNDILAINYQIALALIENNHETLNDDDVAMIFSGSPHAGFMSQRYS
EKFYFHDECQQLDLYRKNIGKLNNQYKRALAFTLMRRAMIRKMPYSRFTI
PWEKVKQLRDEEYSYAKYGRRRAYHNESFQSHFLQNLDDYNQAVFNNGWR
HHAFNQDIFDLLPNIQADAVYLDPPYTGTMNNYFGFYGLLDSYITSSIPK
PFANHFMDKKQAVELFKRVINHLKPFKYWLLSYNNASYPNRDELEEMLGK
NGRNVQILETPHVYKVTGKEKKQSHKEILFLVENT

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAGAAATATCCGAAAATTAACTATATCGGTAATAAAGAGAAAAT
AGCTTCCTGGATTTGTGACCAGCTTCCGTCTGATGTAGATACAGTTGCAG
ATGTATTTAGTGGAGGCTGTTCCTTTGCCTACGAAGCCAAAAAACGCGGC
TATCGTGTGATTACTAACGATATTTTGGCAATTAATTACCAAATTGCTTT
AGCATTAATAGAAAACAACCATGAAACATTAAATGACGATGATGTCGCAA
TGATTTTTTCAGGCAGCCCGCATGCCGGTTTTATGAGTCAGCGTTATTCC
GAAAAATTCTATTTTCACGATGAATGCCAACAACTTGATTTGTACCGTAA
AAATATAGGGAAGCTGAATAACCAGTATAAACGTGCTTTGGCGTTTACTT
TAATGCGTCGCGCCATGATACGTAAAATGCCCTATTCACGATTCACAATT
CCTTGGGAAAAAGTTAAACAACTGCGTGATGAAGAATACAGTTATGCTAA
ATATGGCCGTCGACGCGCCTACCACAATGAAAGTTTTCAAAGTCATTTTC
TGCAAAATTTGGATGACTATAACCAAGCTGTTTTCAATAATGGCTGGCGG
CATCACGCCTTTAATCAAGATATATTTGATTTATTACCTAATATACAAGC
TGATGCCGTCTATTTAGACCCACCTTACACAGGCACGATGAACAATTATT
TTGGCTTTTACGGATTATTGGACAGTTACATTACATCATCCATACCCAAA
CCATTTGCCAATCATTTCATGGATAAAAAGCAGGCTGTCGAATTATTTAA
AAGGGTAATCAATCATTTGAAACCATTTAAATATTGGCTGTTAAGCTACA
ACAATGCTTCATATCCAAACCGAGATGAATTAGAAGAAATGTTAGGTAAA
AATGGGCGAAATGTACAAATCTTGGAAACGCCTCACGTTTATAAGGTTAC
AGGAAAAGAAAAGAAGCAAAGCCATAAGGAAATTCTGTTTTTAGTAGAAA
ATACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy