Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1551 IGR1550 IGR1548.1 IGR1547 IGR1552 IGR1549 IGR1543 IGR1545 IGR1546 IGR1546.1 IGR1548 IGR1544 NG1887 NG1888 NG1880.1 NG1886 NG1880 NG1889 gltS, - NG1890 NG1882 NG1879 NG1883 NG1878 pykA, - NG1881 NG1887 NG1888 NG1880.1 NG1886 NG1880 NG1889 gltS, - NG1890 NG1882 NG1879 NG1883 NG1878 pykA, - NG1881 NG1888 NG1880.1 NG1886 NG1880 NG1889 gltS, - NG1890 NG1887 NG1882 NG1879 NG1883 NG1878 pykA, - NG1881
* Calculated from Protein Sequence

Gene ID: NG1881

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pykA  

Definition:
pyruvate kinase II

Gene Start:
1851538

Gene Stop:
1853007

Gene Length:
1470

Molecular Weight*:
52498

pI*:
5.30

Net Charge*:
-12.44

EC:
2.7.1.40  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism

Secondary Evidence:
Valentini,G., Stoppini,M., Iadarola,P., Malcovati,M., Ferri,G. and
Speranza,M.L.
Divergent binding sites in pyruvate kinases I and II from
Escherichia coli
Biol. Chem. Hoppe-Seyler 374 (1), 69-74 (1993)
Medline: 93176326

Valentini,G., Stoppini,M., Speranza,M.L., Malcovati,M. and Ferri,G.
Bacterial pyruvate kinases have a shorter N-terminal domain
Biol. Chem. Hoppe-Seyler 372 (2), 91-93 (1991)
Medline: 9131575




Comment:
Oklahoma ID: NGO.1881

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST; e.g. residues 15-489 are 49% similar to gb|AAF95156.1| (AE004275) pyruvate kinase II of Vibrio cholerae.

Residues 1-490 are 99% similar to gb|AAF40552.1| (AE002368) pyruvate kinase II of Neisseria meningitidis MC58.




COGS Summary:  COGS Search
BeTs to 11 clades of COG0469
COG name: Pyruvate kinase
Functional Class:  G
The phylogenetic pattern of COG0469 is -m-kY-vCEbrh--gpo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001697 (Pyruvate kinase family) with a combined E-value of 8.9e-142.
    IPB001697A    20-55
    IPB001697B    73-87
    IPB001697C    119-145
    IPB001697D    163-211
    IPB001697E    240-284
    IPB001697F    285-307
    IPB001697G    308-340
    IPB001697H    391-418
    IPB001697H    413-440


ProDom Summary:  Protein Domain Search
Residues 15-489 are 50% similar to a (KINASE PYRUVATE TRANSFERASE GLYCOLYSIS) protein domain (PD001009) which is seen in KPY2_ECOLI.



Paralogs:  Local Blast Search


NG1881 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 360 (E-value = 8.9e-146) place NG1881 in the PK family which is described as Pyruvate kinase, barrel domain (PF00224)
Residues 375 to 488 (E-value = 4.6e-21) place NG1881 in the PK_C family which is described as Pyruvate kinase, alpha/beta domain (PF02887)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
57  
198

PDB Hit:
pdb|1PKM|1PKM MOL_ID: 1; MOLECULE: M1 PYRUVATE KINASE; CHAIN: 297.0 3e-81
pdb|1PKY|1PKY-A PYRUVATE KINASE FROM E. COLI IN THE T-STATE 296.0 5e-81
pdb|1E0U|1E0U-A STRUCTURE R271L MUTANT OF E. COLI PYRUVATE 293.0 4e-80
pdb|1E0T|1E0T-A R292

Gene Protein Sequence:
MNQTSRDLTRISHNTKIVATLGPGSNNVELLEDMIRVGGLNVVRFNFSHG
TPEFHQENARIVREAAKRAGQEIAIIADLQGPKIRVGKIAGGGIELNKGE
TLVLDAALEGEGTREAVGLDYRDLPDDVAAGDVLWLDDGLLTLTVESVEG
SRIITRVENSHILKSNKGINKRGGGLSAGALTEKDFRDLKTAIAIGCDYL
AISFVKSAEDLHIARAKVEEEMKGSTAVRPGLVSKIERVEAIENLDEIIL
AGDGIMVARGDLAVEVGHAAVPALQKRMIRRARELRRFSITATQMMESMI
TNPVPTRAEVSDVANAVLDGTDAVMCSAETAVGAYPFETVSQMAIICAAA
EKEQDSLNGVAEQTEYPEAVSTNLAIAGGAVSVARAVHAKAIVALTESGS
TAFEISRHNITLPIFALTPSVSAQRRMAMYRGVRPLILATSTDHDTALNE
VETMLVEHNILHSGDQYIITSGSQMRESGSTNTLEVLRVK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCAGACAAGCCGCGATCTGACCCGCATCAGCCACAACACCAAAAT
CGTCGCCACCCTTGGGCCGGGCAGCAACAACGTCGAACTGTTGGAAGACA
TGATCCGCGTCGGCGGCCTGAACGTCGTCCGCTTCAACTTCAGCCACGGC
ACGCCCGAATTCCATCAGGAAAACGCCCGCATCGTGCGCGAGGCGGCAAA
ACGCGCCGGACAGGAAATCGCCATCATTGCCGATCTGCAGGGCCCGAAAA
TCCGCGTGGGCAAAATCGCCGGCGGCGGCATCGAATTGAACAAAGGCGAA
ACATTGGTACTCGATGCCGCGCTCGAAGGCGAAGGCACGCGCGAGGCGGT
CGGTTTGGACTACCGCGACCTGCCCGACGACGTTGCCGCAGGCGATGTCT
TGTGGCTGGACGACGGCCTGCTGACCCTGACCGTGGAATCCGTCGAAGGC
AGCAGGATTATCACAAGGGTGGAAAACAGCCACATCCTGAAAAGCAACAA
AGGCATCAACAAACGCGGCGGCGGTTTGTCCGCAGGCGCGTTGACCGAAA
AAGACTTCCGCGACCTGAAAACCGCGATTGCCATCGGTTGCGACTACCTC
GCCATCAGCTTTGTGAAATCCGCCGAAGACCTGCACATCGCGCGCGCCAA
AGTCGAAGAGGAAATGAAGGGCAGCACTGCCGTCCGCCCCGGTTTGGTTT
CCAAAATCGAACGCGTAGAAGCGATTGAAAACCTTGATGAAATCATCCTT
GCCGGCGACGGCATTATGGTTGCGCGCGGCGACTTGGCGGTCGAAGTCGG
ACACGCCGCCGTCCCCGCCCTGCAAAAACGGATGATCCGCCGCGCCCGCG
AGTTGCGCCGCTTCAGCATTACGGCGACGCAAATGATGGAATCGATGATT
ACCAACCCCGTGCCGACCCGCGCGGAAGTCAGCGATGTGGCAAACGCGGT
ATTGGACGGCACCGATGCGGTGATGTGTTCCGCCGAAACCGCCGTCGGCG
CGTATCCGTTTGAAACCGTCAGCCAAATGGCGATTATCTGCGCGGCTGCG
GAAAAAGAGCAGGATTCGCTCAACGGCGTTGCCGAACAGACGGAGTATCC
CGAAGCCGTCAGCACCAACTTAGCGATTGCCGGCGGCGCGGTCAGCGTGG
CGCGCGCGGTTCACGCCAAAGCCATCGTCGCCCTGACCGAAAGCGGTTCG
ACCGCCTTTGAAATCAGCCGCCACAATATTACCCTGCCGATTTTCGCGCT
GACCCCGAGCGTTTCCGCCCAACGCCGTATGGCGATGTACCGGGGCGTGC
GCCCGCTGATTTTGGCAACCAGCACCGACCACGACACGGCGTTGAACGAA
GTCGAAACGATGCTGGTGGAACACAACATCCTGCATTCCGGCGACCAGTA
CATCATCACCAGCGGCTCGCAAATGCGCGAATCCGGTTCGACCAATACGC
TGGAAGTGCTGCGCGTCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy