Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1542 IGR1537 IGR1541 IGR1539 IGR1536 IGR1538 IGR1540 IGR1543 IGR1545 IGR1546 IGR1546.1 IGR1544 NG1872 NG1880.1 pyrI, - NG1876 def, - NG1871 NG1880 NG1875 pryB, - NG1877 fmt, - NG1870 NG1874 NG1879 NG1878 NG1873 pykA, - NG1881 NG1872 NG1880.1 pyrI, - NG1876 def, - NG1871 NG1880 NG1875 pryB, - NG1877 fmt, - NG1870 NG1874 NG1879 NG1878 NG1873 pykA, - NG1881 Type: tandem, Name:  - 86 NG1880.1 pyrI, - NG1876 def, - NG1871 NG1880 NG1875 pryB, - NG1877 fmt, - NG1870 NG1872 NG1874 NG1879 NG1878 NG1873 pykA, - NG1881
* Calculated from Protein Sequence

Gene ID: NG1877

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pryB  

Definition:
aspartate carbamoyltransferase

Gene Start:
1847152

Gene Stop:
1846235

Gene Length:
918

Molecular Weight*:
34182

pI*:
6.30

Net Charge*:
-3.24

EC:
2.1.3.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Alanine and aspartate metabolism
Pyrimidine metabolism

Comment:
Oklahoma ID: NGO.1877c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST; e.g. residues 1-306 are 64% similar to gb|AAF95652.1| (AE004321) aspartate carbamoyltransferase, catalytic subunit of Vibrio cholerae.

Residues 1-306 are 97% similar to emb|CAB83482.1| (AL162752) aspartate carbamoyltransferase catalytic chain of Neisseria meningitidis Z2491.




COGS Summary:  COGS Search
BeTs to 12 clades of COG0540
COG name: Aspartate carbamoyltransferase, catalytic chain
Functional Class:  F
The phylogenetic pattern of COG0540 is amtkyqvcebr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002029 (Aspartate and ornithine carbamoyltransferase family) with a combined E-value of 6.4e-61.
    IPB002029A    42-69
    IPB002029B    80-105
    IPB002029C    123-161
    IPB002029D    255-276


ProDom Summary:  Protein Domain Search
Residues 67-286 are 63% similar to a (CARBAMOYLTRANSFERASE TRANSFERASE BIOSYNTHESIS ORNITHINE) protein domain (PD000708) which is seen in PYRB_VIBS2.

Residues 8-64 are 61% similar to a (CARBAMOYLTRANSFERASE TRANSFERASE BIOSYNTHESIS ORNITHINE) protein domain (PD000765) which is seen in PYRB_VIBS2.



Paralogs:  Local Blast Search


NG1877 is paralogously related to NG1232 (ornithine carbamoyltransferase (OTCase)) (3e-15).


Pfam Summary:  Pfam Search
Residues 8 to 148 (E-value = 8.7e-68) place NG1877 in the OTCace_N family which is described as Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain (PF02729)
Residues 151 to 302 (E-value = 7.5e-52) place NG1877 in the OTCace family which is described as Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain (PF00185)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1EKX|1EKX-A THE ISOLATED, UNREGULATED CATALYTIC TRIMER OF 380.0 0e+00
pdb|1RAA|1RAA-A ASPARTATE TRANSCARBAMOYLASE (E.C.2.1.3.2) 378.0 0e+00
pdb|1D09|1D09-A ASPARTATE TRANSCARBAMOYLASE COMPLEXED WITH 378.0 0e+00
pdb|9ATC|9ATC-A ATCA

Gene Protein Sequence:
MPNPLYRQHIISISDLSREQLEYLLQTALKLKAHPRGDLLEGKLIGSCFF
EPSTRTRLSFETAVQRLGGKVIGFSDGANTSAKKGETLADTARIISGYTD
AIVQRHPKDGAARVAAEFSRVPVINAGDGTNQHPSQTLLDLVTIYETQGR
LDKLKIAMAGDLKYGRTVHSLCQALKRWGCEFAFVSPPSLAMPDYITEEL
EEADCRYRALGSLEEAAEWADILYMTRVQRERFDEQEFAKIQGKFNLEAS
MLARAKPNLRVLHPLPRTDEIHPDVDAAPHAYYFEQATNGVYARMAILSL
VLNEEV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTAATCCGCTTTACAGACAGCACATCATCTCCATTTCGGATTTGTC
GCGCGAACAGTTGGAATACCTGCTTCAGACGGCATTGAAGCTGAAGGCGC
ATCCGCGCGGCGATTTGTTGGAAGGCAAACTCATCGGTTCGTGCTTTTTC
GAGCCGTCCACGCGCACGAGGCTGTCGTTTGAAACGGCGGTGCAGCGTTT
GGGCGGTAAGGTCATCGGCTTTTCGGACGGCGCGAATACCAGTGCCAAAA
AAGGCGAAACGCTTGCCGATACCGCCCGTATCATTTCCGGCTACACCGAC
GCGATTGTCCAACGCCATCCCAAAGACGGCGCGGCGCGCGTGGCGGCGGA
GTTTTCGCGCGTCCCCGTCATCAACGCCGGCGACGGCACGAACCAACACC
CCAGCCAAACCTTGTTGGACCTGGTAACGATTTATGAAACGCAGGGGCGT
TTGGACAAGCTTAAAATCGCCATGGCGGGCGACTTGAAATACGGGCGCAC
CGTGCATTCGCTGTGTCAGGCGTTGAAACGCTGGGGCTGCGAATTTGCCT
TCGTCTCGCCGCCCAGCCTCGCGATGCCCGACTACATTACCGAAGAGTTG
GAAGAAGCCGACTGCCGATACCGCGCCCTCGGCAGTTTGGAAGAGGCGGC
GGAATGGGCGGACATCCTGTATATGACCCGCGTCCAGCGCGAACGTTTCG
ACGAACAGGAATTTGCCAAAATCCAAGGCAAATTCAACCTCGAAGCGTCT
ATGCTCGCCCGCGCCAAACCGAACCTGCGCGTGCTGCACCCCCTGCCGCG
CACGGACGAAATCCACCCCGATGTCGATGCCGCGCCGCACGCCTATTATT
TCGAGCAGGCGACCAACGGCGTTTATGCGCGTATGGCGATATTGTCGCTG
GTGTTGAACGAAGAAGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy