Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1542 IGR1537 IGR1541 IGR1539 IGR1535 IGR1536 IGR1538 IGR1540 IGR1543 IGR1545 IGR1546 IGR1544 NG1872 NG1880.1 pyrI, - NG1876 def, - NG1871 NG1880 NG1875 pryB, - NG1877 fmt, - NG1870 fmu, - NG1869 NG1874 NG1879 NG1878 NG1873 NG1872 NG1880.1 pyrI, - NG1876 def, - NG1871 NG1880 NG1875 pryB, - NG1877 fmt, - NG1870 fmu, - NG1869 NG1874 NG1879 NG1878 NG1873 Type: tandem, Name:  - 86 pyrI, - NG1876 def, - NG1871 NG1880 NG1875 pryB, - NG1877 fmt, - NG1870 fmu, - NG1869 NG1872 NG1880.1 NG1874 NG1879 NG1878 NG1873
* Calculated from Protein Sequence

Gene ID: NG1876

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrI  

Definition:
aspartate carbamoyltransferase, regulatory subunit

Gene Start:
1846222

Gene Stop:
1845767

Gene Length:
456

Molecular Weight*:
16899

pI*:
9.30

Net Charge*:
7.20

EC:
2.1.3.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Alanine and aspartate metabolism
Pyrimidine metabolism

Secondary Evidence:
Aspartate carbamoyltransferase from a psychrophilic deep-sea bacterium, Vibrio strain 2693: properties of the enzyme, genetic organization and synthesis in Escherichia coli, Microbiology 144 (Pt 5), 1435-1441 (1998). Medline: 98274751


Comment:
Oklahoma ID: NGO.1876c

For other 'pyr' genes, see NG0029 (pyrE), NG0255 (pyrC), NG0401 (pyrF), NG0589 (pyrP), NG1212 (pyrG), NG1761 (pyrD), NG1973 (pyrH).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST; e.g. residues 5-151 are 51% similar to gb|AAF95653.1| (AE004321) aspartate carbamoyltransferase, regulatory subunit of Vibrio cholerae.

Residues 1-152 are 96% similar to gb|AAF40566.1| (AE002369) aspartate carbamoyltransferase, regulatory subunit of Neisseria meningitidis MC58.



COGS Summary:  COGS Search
BeTs to 6 clades of COG1781
COG name: Aspartate carbamoyltransferase regulatory subunit
Functional Class:  F
The phylogenetic pattern of COG1781 is amtk--v-e------------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002801 (Aspartate carbamoyltransferase regulatory chain) with a combined E-value of 5.5e-51.
    IPB002801A    6-21
    IPB002801B    69-116
    IPB002801C    135-151


ProDom Summary:  Protein Domain Search
Residues 5-151 are 50% similar to a (ASPARTATE CARBAMOYLTRANSFERASE REGULATORY) protein domain (PD006194) which is seen in PYRI_SERMA.



Paralogs:  Local Blast Search


NG1876 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 98 (E-value = 1.6e-38) place NG1876 in the PyrI family which is described as Aspartate carbamoyltransferase regulatory chain, allosteric domain (PF01948)
Residues 100 to 151 (E-value = 2.5e-17) place NG1876 in the PyrI_C family which is described as Aspartate carbamoyltransferase regulatory chain, metal binding domain (PF02748)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1ACM|1ACM-B ASPARTATE CARBAMOYLTRANSFERASE (ASPARTATE 149.0 2e-37
pdb|1D09|1D09-B ASPARTATE TRANSCARBAMOYLASE COMPLEXED WITH 149.0 2e-37
pdb|1NBE|1NBE-B ASPARTATE TRANSCARBOMYLASE REGULATORY CHAIN 149.0 2e-37
pdb|2AT1|2AT1-B ASPA

Gene Protein Sequence:
MEAQKLSVEAIEKGTVIDHIPAGRGLTILRQFKLLHYGNAVTVGFNLPSK
TQGSKDIIKIKGVCLDDKAADRLALFAPEAVVNTIDNFKVVQKRHLTLPD
EIAEVFRCPNPNCAGHGEPVKSRFYVKKHNGQTRLKCHYCEKTYNRDSVA
EA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGCGCAAAAACTCAGTGTCGAAGCCATCGAAAAAGGCACGGTTAT
CGACCATATTCCCGCCGGCAGGGGGCTGACCATCCTGCGCCAGTTCAAAC
TTTTGCACTACGGCAACGCGGTAACCGTGGGCTTCAACCTGCCCAGCAAA
ACCCAGGGCAGCAAAGACATCATCAAAATCAAAGGCGTGTGCTTGGACGA
TAAAGCCGCCGACCGCCTCGCCCTGTTCGCCCCCGAAGCGGTGGTCAACA
CCATCGACAATTTCAAGGTCGTACAGAAGCGGCATTTGACCCTGCCCGAC
GAAATCGCCGAAGTGTTCCGCTGCCCGAATCCCAATTGCGCCGGCCACGG
CGAGCCGGTCAAAAGCCGGTTTTATGTTAAGAAACACAACGGGCAGACGC
GGCTGAAATGCCACTACTGCGAAAAAACCTACAACCGGGATTCGGTGGCG
GAAGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy