Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1534 IGR1542 IGR1537 IGR1541 IGR1539 IGR1535 IGR1536 IGR1538 IGR1540 NG1872 pyrI, - NG1876 def, - NG1871 NG1875 pryB, - NG1877 fmt, - NG1870 fmu, - NG1869 hydH,atoS, - NG1867 NG1874 NG1873 NG1872 pyrI, - NG1876 def, - NG1871 NG1875 pryB, - NG1877 fmt, - NG1870 fmu, - NG1869 hydH,atoS, - NG1867 NG1874 NG1873 Type: tandem, Name:  - 86 pyrI, - NG1876 def, - NG1871 NG1875 pryB, - NG1877 fmt, - NG1870 fmu, - NG1869 hydH,atoS, - NG1867 NG1868 ntrX,hydG, - NG1866 NG1868 ntrX,hydG, - NG1866 NG1872 NG1874 NG1873
* Calculated from Protein Sequence

Gene ID: NG1870

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fmt  

Definition:
methionyl-tRNA formyltransferase

Gene Start:
1842405

Gene Stop:
1841482

Gene Length:
924

Molecular Weight*:
32814

pI*:
5.60

Net Charge*:
-4.21

EC:
2.1.2.9  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Methionine metabolism
One carbon pool by folate

Secondary Evidence:
Mazel,D., Coic,E., Blanchard,S., Saurin,W. and Marliere,P.
A survey of polypeptide deformylase function throughout the
eubacterial lineage
J. Mol. Biol. 266 (5), 939-949 (1997)
Medline: 97240812

Schmitt,E., Blanquet,S. and Mechulam,Y.
Structure of crystalline Escherichia coli methionyl-tRNA(f)Met
formyltransferase: comparison with glycinamide ribonucleotide
formyltransferase
EMBO J. 15 (17), 4749-4758 (1996)
Medline: 97042366


Meinnel,T., Guillon,J.M., Mechulam,Y. and Blanquet,S.
The Escherichia coli fmt gene, encoding methionyl-tRNA(fMet)
formyltransferase, escapes metabolic control
J. Bacteriol. 175 (4), 993-1000 (1993)
Medline: 93163064

Guillon,J.M., Mechulam,Y., Schmitter,J.M., Blanquet,S. and Fayat,G.
Disruption of the gene for Met-tRNA(fMet) formyltransferase
severely impairs growth of Escherichia coli
J. Bacteriol. 174 (13), 4294-4301 (1992)
Medline: 92325012


Comment:
Oklahoma ID: NGO.1870c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST; e.g. residues 1-292 are 50% similar to gb|AAC76313.1| (AE000407) 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase of Escherichia coli K12.

Residues 1-308 are 91% similar to emb|CAB83477.1| (AL162752) methionyl-tRNA formyltransferase of Neisseria meningitidis Z2491.




COGS Summary:  COGS Search
BeTs to 13 clades of COG0223
COG name: Methionyl-tRNA formyltransferase
Functional Class:  J
The phylogenetic pattern of COG0223 is ----yQvcEbRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001555 (Phosphoribosylglycinamide formyltransferase active site) with a combined E-value of 6.6e-08.
    IPB001555    105-117


ProDom Summary:  Protein Domain Search
Residues 29-184 are 57% similar to a (TRANSFERASE PROTEIN FORMYLTRANSFERASE BIOSYNTHESIS) protein domain (PD001209) which is seen in FMT_ECOLI.

Residues 200-292 are 50% similar to a (TRANSFERASE FORMYLTRANSFERASE PROTEIN METHIONYL-TRNA) protein domain (PD004966) which is seen in FMT_ECOLI.



Paralogs:  Local Blast Search


NG1870 is paralogously related to NG1224 (phosphoribosylglycinamide formyltransferase) (2e-07).


Pfam Summary:  Pfam Search
Residues 1 to 181 (E-value = 3.2e-43) place NG1870 in the Formyl_trans_N family which is described as Formyl transferase (PF00551)
Residues 207 to 301 (E-value = 1.1e-34) place NG1870 in the Formyl_trans_C family which is described as Formyl transferase, C-terminal domain (PF02911)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
97
transmembrane  
14  
30

PDB Hit:
pdb|1FMT|1FMT-A METHIONYL-TRNAFMET FORMYLTRANSFERASE FROM 278.0 1e-75
pdb|1C2T|1C2T-A NEW INSIGHTS INTO INHIBITOR DESIGN FROM THE 44.5 2e-05
pdb|2GAR|2GAR A PH-DEPENDENT STABLIZATION OF AN ACTIVE SITE 44.5 2e-05
pdb|1C3E|1C3E-A NEW

Gene Protein Sequence:
MKVIFAGTPDFAAAALKAVAAAGFEIPLVLTQPDRPKGRGMQLTAPPVKQ
AALELGLRVAQPEKLRNNAEALQMLKEVEADVMVVAAYGLILPQEVLDTP
KHGCLNIHASLLPRWRGAAPIQRAIEAGDAETGVCIMQMDIGLDTGDVVS
EHRYAIQPTDTANEVHDALMEIGAAAVVADLQQLQSKGRLNAVKQPEEGV
TYAQKLSKEEARIDWSESADIIERKIRAFNPVPAAWVEYQGKPMKIRRAE
VVAQQGTAGEVLSCSADGLVVACGESALKITELQPAGGRRMNIAAFAAGR
SIEAGAKL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTCATCTTTGCCGGCACGCCCGATTTTGCCGCCGCCGCCTTAAA
AGCCGTTGCCGCCGCCGGTTTTGAAATCCCGCTGGTGCTGACCCAGCCCG
ACCGTCCGAAAGGGCGCGGTATGCAACTGACCGCCCCGCCTGTCAAACAA
GCCGCGCTGGAACTCGGTTTGCGCGTGGCACAGCCCGAAAAACTGCGCAA
CAACGCCGAAGCCCTGCAAATGCTCAAAGAGGTCGAGGCGGACGTAATGG
TGGTTGCCGCGTACGGCTTGATTCTGCCGCAGGAAGTGTTGGATACGCCG
AAACACGGCTGCCTCAATATCCACGCTTCGCTGCTGCCCCGTTGGCGCGG
CGCGGCGCCGATTCAGCGCGCGATTGAGGCCGGCGATGCCGAAACCGGCG
TGTGCATTATGCAGATGGACATCGGTTTGGACACCGGCGATGTGGTCAGC
GAACACCGCTACGCCATCCAACCTACCGATACCGCCAACGAAGTCCACGA
CGCGCTGATGGAAATCGGTGCGGCGGCGGTTGTTGCCGATTTGCAACAGC
TTCAAAGCAAAGGCCGTCTGAACGCGGTCAAACAGCCCGAAGAAGGCGTA
ACTTACGCCCAAAAACTAAGCAAAGAAGAAGCGCGTATCGATTGGAGCGA
AAGCGCGGACATTATCGAACGCAAAATCCGCGCCTTCAACCCCGTGCCTG
CCGCGTGGGTCGAATATCAGGGCAAGCCGATGAAAATCCGGCGTGCCGAA
GTGGTGGCGCAACAAGGTACGGCAGGCGAAGTGTTGTCCTGTTCGGCGGA
CGGTTTGGTCGTTGCCTGCGGCGAAAGCGCGCTGAAGATTACCGAATTGC
AGCCTGCCGGCGGCAGGCGTATGAATATTGCGGCGTTTGCGGCGGGACGG
TCTATTGAAGCAGGGGCGAAGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy