Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1534 IGR1532 IGR1537 IGR1531 IGR1535 IGR1533 IGR1536 IGR1538 NG1872 NG1864 def, - NG1871 fmt, - NG1870 smf,dprA, - NG1865 fmu, - NG1869 hydH,atoS, - NG1867 topA, - NG1863 NG1873 NG1872 NG1864 def, - NG1871 fmt, - NG1870 smf,dprA, - NG1865 fmu, - NG1869 hydH,atoS, - NG1867 topA, - NG1863 NG1873 Type: tandem, Name:  - 86 NG1864 def, - NG1871 fmt, - NG1870 smf,dprA, - NG1865 fmu, - NG1869 hydH,atoS, - NG1867 topA, - NG1863 NG1868 ntrX,hydG, - NG1866 NG1868 ntrX,hydG, - NG1866 NG1872 NG1873
* Calculated from Protein Sequence

Gene ID: NG1867

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hydH  atoS  

Definition:
probable two-component system sensor kinase

Gene Start:
1839576

Gene Stop:
1837459

Gene Length:
2118

Molecular Weight*:
76714

pI*:
6.50

Net Charge*:
-4.04

EC:
2.7.3.-  

Functional Class:
Regulatory functions; Two component system  

Pathway: pathway table

Secondary Evidence:
Blattner,F.R.,Burland,V.,Plunkett,G.3rd,Sofia,H.J.and
Daniels,D.L.
Analysis of the Escherichia coli genome. IV. DNA sequence of the
region from 89.2 to 92.8 minutes
Nucleic Acids Res. 21 (23), 5408-5417 (1993)
Medline: 94089392

Stoker,K., Reijnders,W.N., Oltmann,L.F. and Stouthamer,A.H.
Initial cloning and sequencing of hydHG, an operon homologous to
ntrBC and regulating the labile hydrogenase activity in Escherichia coli K-12
J. Bacteriol. 171 (8), 4448-4456 (1989)
Medline: 89327164

Canellakis,E.S., Paterakis,A.A., Huang,S.C., Panagiotidis,C.A. and
Kyriakidis,D.A.
Identification, cloning, and nucleotide sequencing of the ornithine decarboxylase antizyme gene of Escherichia coli
Proc. Natl. Acad. Sci. U.S.A. 90 (15), 7129-7133 (1993)
Medline: 93348226




Comment:
For other 'hyd' genes see NG1866 (hydG).

Oklahoma ID: NGO.1867c

Blast Summary:  PSI-Blast Search
Residues 1-706 are 85% similar to nitrogen regulation protein NtrY
from (11353811|).

Numerous hits in gapped BLAST to probable two-component sensor sequences,e.g.residues 289-699 are 26% similar to probable two-component sensor from Pseudomonas aeruginosa strain PAO1 (11352392|).Residues 477-702 are 33% similar to sensor kinase for HydG, hydrogenase 3 activity from Escherichia coli K12 (|gb|AAC76977.1|).Residues 289-699 are 22% similar to sensor protein AtoS from Escherichia coli strain K-12 (7466912|).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0642
COG name: Sensory transduction histidine kinases
Functional Class:  T
The phylogenetic pattern of COG0642 is AMT-YQVCEBRHUJ--O-inX
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** PR00344 (Bacterial sensor protein C-terminal signature) with a combined E-value of 1.6e-13.
    PR00344A    633-647
    PR00344B    651-661
    PR00344C    662-680
    PR00344D    686-699
***** IPB000122 (Bacterial chemotaxis sensory transducer) with a combined E-value of 1e-08.
    IPB000122A    298-346
    IPB000122C    594-631


ProDom Summary:  Protein Domain Search
Residues 476-576 are 47% similar to a (NTRY NITROGEN REGULATION PROTEIN) protein domain (PD021626) which is seen in NTRY_AZOCA.

Residues 590-699 are 33% similar to a (KINASE PROTEIN SENSORY TRANSDUCTION HISTIDINE SENSOR) protein domain (PD000064) which is seen in FIXL_RHIME.



Paralogs:  Local Blast Search


NG1867 is paralogously related to NG0176 (sensor histidine kinase of two-component system) (2e-08) and NG0112 (sensor component of two-component regulatory system, BasS) (3e-04).


Pfam Summary:  Pfam Search
Residues 276 to 345 (E-value = 5.5e-18) place NG1867 in the HAMP family which is described as HAMP domain (PF00672)
Residues 483 to 555 (E-value = 6.3e-09) place NG1867 in the HisKA family which is described as His Kinase A (phosphoacceptor) domain (PF00512)
Residues 593 to 701 (E-value = 1.7e-30) place NG1867 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
30
cleavable N-terminal sequence  
1  
30
transmembrane  
43  
59
transmembrane  
77  
93
transmembrane  
276  
292
coil-coil  
536  
568

PDB Hit:
pdb|1BXD|1BXD-A NMR STRUCTURE OF THE HISTIDINE KINASE DOMAIN OF 62.1 3e-10
pdb|1ID0|1ID0-A CRYSTAL STRUCTURE OF THE NUCLEOTIDE BOND 40.3 0.001000
pdb|1BXD|1BXD-A NMR STRUCTURE OF THE HISTIDINE KINASE DOMAIN OF 199.0 1e-51
pdb|1ID0|1ID0-A CR

Gene Protein Sequence:
MRRFLPIAAICAVVLLYGLTAATGSTSSLADYFWWIVSFSAMLLLVLSAV
LARYVILLLKDRRNGVFGSQIAKRLSGMFTLVAVLPGLFLFGISAQFING
TINSWFGNDTHEALERSLNLSKSALDLAADNAVSNAVPVQIDLIGTASLS
GNMGSVLEHYAGSGFAQLALYNAASGKIEKSINPHQFDQPLPDKEHWEQI
QQTGSVRSLESIGGVLYAQGWLSAGTHNGRDYALFFRQPIPENVAQDAVL
IEKARAKYAELSYSKKGLQTFFLVTLLIASLLSIFLALVMALYFARRFVE
PILSLAEGAKAVAQGDFSQTRPVLRNDEFGRLTKLFNHMTEQLSIAKEAD
ERNRRREEAARHYLECVLDGLTTGVVVFDEKGRLKTFNKAAEQILGMPLA
PLWGSSRHGWHGVSAQQSLLAEVFAAIGAAAGTDKPVQVEYAAPDDAKIL
LGKATVLPEDNGNGVVMVIDDITVLIRAQKEAAWGEVAKRLAHEIRNPLT
PIQLSAERLAWKLGGKLDDQDAQILTRSTDTIIKQVAALKEMVEAFRNYA
RAPSLKLENQDLNALIGDVLALYEAGPCRFEAELAGEPLMMAADTTAMRQ
VLHNIFKNAAEAAEEADMPEVRVKSETGQDGRIVLTVCDNGKGFGKEMLH
NAFEPYVTDKPAGTGLGLPVVKKIIGEHGGRISLSNQDAGGACVRIILPK
TVETYA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCCGCTTCCTACCGATCGCAGCCATATGCGCCGTCGTCCTGCTGTA
CGGATTGACGGCGGCGACCGGCAGCACCAGTTCGCTGGCGGATTATTTCT
GGTGGATAGTCTCGTTCAGCGCAATGCTGCTGCTGGTGTTGTCCGCCGTT
TTGGCACGTTATGTCATATTGCTGTTGAAAGACAGGCGCAACGGCGTGTT
CGGTTCGCAGATTGCCAAACGCCTTTCCGGGATGTTCACGCTGGTCGCCG
TACTGCCCGGCTTGTTCCTGTTCGGCATTTCCGCGCAGTTTATCAACGGC
ACGATTAATTCGTGGTTCGGCAACGACACCCACGAAGCCCTCGAACGCAG
CCTTAATTTGAGCAAGTCCGCACTGGATTTGGCGGCAGACAATGCCGTCA
GCAACGCCGTTCCCGTACAGATAGACCTCATCGGCACCGCCTCCCTGTCG
GGCAATATGGGCAGTGTGCTGGAACACTACGCCGGCAGCGGTTTTGCCCA
GCTTGCCCTGTACAATGCCGCAAGCGGGAAAATCGAAAAAAGCATCAATC
CGCACCAATTCGACCAGCCGCTTCCCGACAAAGAACATTGGGAACAGATT
CAGCAGACCGGTTCGGTTCGGAGTTTGGAAAGCATAGGCGGCGTATTGTA
CGCGCAGGGATGGTTGTCGGCAGGTACGCACAACGGGCGCGATTACGCGC
TGTTCTTCCGCCAGCCGATTCCCGAAAATGTGGCACAGGATGCCGTTCTG
ATTGAAAAGGCGCGGGCGAAATATGCCGAATTGAGTTACAGCAAAAAAGG
TTTGCAGACCTTTTTTCTGGTAACCCTGCTGATTGCCTCGCTGCTGTCGA
TTTTTCTTGCGCTGGTAATGGCACTGTATTTTGCCCGCCGTTTCGTCGAA
CCCATTCTGTCGCTTGCCGAGGGCGCAAAGGCGGTGGCGCAGGGTGATTT
CAGCCAGACGCGCCCCGTATTGCGCAACGACGAGTTCGGACGTTTGACCA
AGCTGTTCAACCATATGACCGAGCAGCTTTCCATCGCCAAAGAAGCAGAC
GAACGCAACCGCCGGCGCGAGGAAGCCGCCCGTCACTACCTCGAGTGCGT
GTTGGATGGGTTGACTACCGGTGTGGTGGTGTTTGACGAAAAAGGCCGTT
TGAAAACCTTCAACAAGGCGGCGGAACAGATTTTGGGGATGCCGCTCGCC
CCCCTGTGGGGCAGCAGCCGGCACGGTTGGCACGGCGTTTCGGCGCAGCA
GTCCCTGCTTGCCGAAGTGTTTGCCGCCATCGGTGCGGCGGCAGGTACGG
ACAAACCGGTCCAGGTGGAATATGCCGCGCCGGACGATGCCAAAATCCTG
CTGGGCAAGGCGACGGTATTGCCCGAAGACAACGGCAACGGCGTGGTGAT
GGTGATTGACGACATCACCGTGCTGATACGCGCGCAAAAAGAAGCCGCGT
GGGGTGAAGTGGCGAAGCGGCTGGCACACGAAATCCGCAATCCGCTCACG
CCCATCCAGCTTTCCGCCGAACGGCTGGCGTGGAAATTGGGCGGGAAGCT
GGACGATCAGGACGCGCAAATCCTGACGCGTTCGACCGACACCATCATCA
AACAGGTGGCGGCGTTAAAAGAAATGGTCGAGGCATTCCGCAATTACGCG
CGCGCCCCTTCGCTCAAACTGGAAAATCAGGATTTGAACGCCTTAATCGG
CGATGTTTTGGCCCTGTACGAAGCCGGCCCGTGCCGGTTTGAGGCGGAAC
TTGCCGGCGAACCGCTGATGATGGCGGCGGATACGACCGCCATGCGGCAG
GTGCTGCACAATATTTTCAAAAATGCCGCCGAAGCGGCGGAAGAAGCCGA
TATGCCCGAAGTCAGGGTAAAATCGGAAACGGGGCAGGACGGACGGATTG
TCCTGACGGTTTGCGACAACGGCAAGGGATTCGGCAAGGAAATGCTGCAC
AATGCTTTCGAGCCGTATGTGACGGATAAGCCGGCGGGAACGGGACTGGG
TCTGCCTGTAGTGAAAAAAATCATTGGAGAACACGGCGGCCGCATCAGCC
TGAGCAATCAGGATGCGGGTGGGGCGTGTGTCAGAATCATCTTGCCAAAA
ACGGTAGAAACTTATGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy