Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-4 tRNA-Thr-3 tRNA-Tyr-1 IGR1532 IGR1531 IGR1533 IGR1529 IGR1528 IGR1527 IGR1530 fdx, - NG1859 NG1861 NG1864 yhhF, - NG1860 tufA, - NG1858 smf,dprA, - NG1865 hydH,atoS, - NG1867 topA, - NG1863 fdx, - NG1859 NG1861 NG1864 yhhF, - NG1860 tufA, - NG1858 smf,dprA, - NG1865 hydH,atoS, - NG1867 topA, - NG1863 Type: tandem, Name:  - 85 Type: direct, Name:  - 118 fdx, - NG1859 NG1861 NG1864 yhhF, - NG1860 tufA, - NG1858 smf,dprA, - NG1865 hydH,atoS, - NG1867 topA, - NG1863 ntrX,hydG, - NG1866 ntrX,hydG, - NG1866
* Calculated from Protein Sequence

Gene ID: NG1863

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
topA  

Definition:
DNA topoisomerase I

Gene Start:
1834343

Gene Stop:
1832040

Gene Length:
2304

Molecular Weight*:
87042

pI*:
7.90

Net Charge*:
7.86

EC:
5.99.1.2  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Tse-Dinh,Y.C. and Wang,J.C.
Complete nucleotide sequence of the topA gene encoding Escherichia
coli DNA topoisomerase I
J. Mol. Biol. 191 (3), 321-331 (1986)
Medline: 87141163

Ostrowski,J., Jagura-Burdzy,G. and Kredich,N.M.
DNA sequences of the cysB regions of Salmonella typhimurium and
Escherichia coli
J. Biol. Chem. 262 (13), 5999-6005 (1987)
Medline: 87194810


Comment:
Oklahoma ID: NGO.1863c

Blast Summary:  PSI-Blast Search
Residues 1-768 are 95% similar to DNA topoisomerase I from Neisseria meningitidis group A strain Z2491 (11279674|).

Numerous hits in gapped BLAST to DNA topoisomerase I sequences,e.g.residues 1-716 are 42% similar to probable DNA topoisomerase I-fused to SWI domain from Chlamydia trachomatis serotype D, strain UW3/Cx (7437435|).Residues 1-715 are 40% similar to DNA topoisomerase I from Pseudomonas aeruginosa
strain PAO1 (11348457|).Residues 3-719 are 40% similar to DNA topoisomerase I from syphilis spirochete,Treponema pallidum (3322672|).Residues 1-715 are 40% similar to DNA topoisomerase I from Escherichia coli K12 (gb|AAC74356.1|).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0550
COG name: Topoisomerase IA
Functional Class:  L
The phylogenetic pattern of COG0550 is amtkyqvcEBrHUJgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000380 (Prokaryotic DNA topoisomerase I) with a combined E-value of 8e-176.
    IPB000380A    5-17
    IPB000380B    20-37
    IPB000380C    77-94
    IPB000380D    111-122
    IPB000380E    137-160
    IPB000380F    166-197
    IPB000380G    260-290
    IPB000380H    300-316
    IPB000380I    343-357
    IPB000380J    376-393
    IPB000380K    461-500
    IPB000380L    524-542


ProDom Summary:  Protein Domain Search
Residues 315-365 are 58% similar to a (TOPOISOMERASE ENZYME DNA ISOMERASE) protein domain (PD004360) which is seen in TOP1_HELPY.

Residues 598-756 are 44% similar to a (TOPOISOMERASE ISOMERASE DNA ENZYME) protein domain (PD003328) which is seen in YRDD_ECOLI.

Residues 5-189 are 60% similar to a (TOPOISOMERASE ISOMERASE DNA ENZYME DNA-BINDING I) protein domain (PD001285) which is seen in Q9ZDK2_RICPR.

Residues 228-314 are 48% similar to a (TOPOISOMERASE ISOMERASE DNA ENZYME I DNA-BINDING) protein domain (PD001593) which is seen in O34204_FERIS.

Residues 370-558 are 44% similar to a (TOPOISOMERASE ISOMERASE DNA ENZYME DNA-BINDING I) protein domain (PD001411) which is seen in TOP1_BACSU.



Paralogs:  Local Blast Search


NG1863 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 115 (E-value = 3e-32) place NG1863 in the Toprim family which is described as Toprim domain (PF01751)
Residues 129 to 543 (E-value = 2.2e-179) place NG1863 in the Topoisom_bac family which is described as DNA topoisomerase (PF01131)
Residues 582 to 621 (E-value = 6.4e-15) place NG1863 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)
Residues 641 to 680 (E-value = 1.4e-17) place NG1863 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)
Residues 684 to 724 (E-value = 2.9e-13) place NG1863 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
615  
642

PDB Hit:
pdb|1CY0|1CY0-A COMPLEX OF E.COLI DNA TOPOISOMERASE I WITH 454.0 0e+00
pdb|1ECL|1ECL AMINO TERMINAL 67KDA DOMAIN OF ESCHERICHIA COLI 454.0 0e+00
pdb|1GL9|1GL9-B ARCHAEOGLOBUS FULGIDUS REVERSE GYRASE COMPLEXED 188.0 4e-48
pdb|1GKU|1GKU-B REVE

Gene Protein Sequence:
MAKNLLIVESPSKAKTLKKYLGGDFEILASYGHVRDLVPKSGAVDPDNGF
AMKYQLISRNGKHVDAIVAAAKEAENIYLATDPDREGEAISWHLLEILKS
KRGLKNIKPQRVVFHEITKNAVLDAVAHPREIEMDLVDAQQARRALDYLV
GFNLSPLLWKKIRRGLSAGRVQSPALRLICERENEIRAFEAQEYWTVHLD
SHKGRSKFTAKLAQYNGAKLEQFDLPNEAAQADVLKELEGKEAVVTAIEK
KKRSRNPAAPFTTSTMQQDAVRKLGFTTDRTMRTAQQLYEGIDVGQGAIG
LITYMRTDSVNLADEALTEIRHYIENKIGKEYLPSAAKQYKTKSKNAQEA
HEAIRPTSVYRTPESVKPFLSADQFKLYQMIWQRTVACQMTPAKFDQTTV
DITVGKGVFRVTGQVQTFAGFLSVYEESSDDEESEDSKKLPEMSEGDKLP
VDKLYGEQHFTTPPPRYNEATLVKALEEYGIGRPSTYASIISTLKDREYV
TLEQKRFMPTDTGDIVNKFLTEHFAQYVDYHFTAKLEDQLDEIADGKRRW
IPVMDKFWKPFIKQVEEKEGIERAKFTTQELDETCPKCGEHKLQIKFGKM
GRFVACAGYPECSYTRNVNETAEEAAERIAKAEAEQVELDGRECPKCGGR
LVYKYSRTGSKFIGCANYPKCKHVEPLEKPKDTGVQCPQCKKGNLVERKS
RYGKLFYSCSTYPDCNYATWNPPVAEECPNCHWPVLAIKTTKRRGVEKVC
PQKECGWKEQIEPPAPQE

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGAAAAACCTCTTAATCGTCGAATCCCCGTCCAAAGCCAAAACCCT
GAAAAAATATTTGGGCGGCGATTTTGAAATCCTCGCGTCCTACGGACACG
TCCGCGACCTCGTCCCCAAAAGCGGCGCGGTCGATCCCGACAACGGCTTT
GCGATGAAATACCAACTCATCAGCCGCAACGGCAAACATGTCGATGCGAT
TGTTGCCGCTGCCAAAGAAGCCGAAAACATCTACCTCGCAACCGACCCGG
ACAGGGAAGGCGAAGCGATTTCTTGGCATCTTTTGGAAATCCTCAAATCC
AAACGCGGTCTGAAAAACATCAAGCCGCAGCGCGTCGTGTTCCACGAGAT
TACCAAAAACGCCGTGCTCGATGCCGTCGCCCATCCTCGCGAAATCGAAA
TGGATTTGGTCGATGCGCAACAAGCCCGCCGCGCTTTGGACTATCTGGTC
GGTTTCAACCTCTCGCCGTTGCTGTGGAAAAAAATCCGACGCGGTTTGAG
CGCGGGCCGTGTGCAAAGTCCCGCCCTGCGGCTGATTTGCGAGCGCGAAA
ACGAAATCCGCGCGTTTGAAGCGCAGGAATATTGGACGGTGCATCTCGAC
AGCCATAAAGGCCGCAGCAAGTTCACCGCCAAACTCGCCCAATACAACGG
CGCGAAACTCGAACAATTCGACCTGCCGAACGAAGCCGCTCAAGCCGATG
TGTTGAAAGAACTCGAAGGCAAAGAGGCCGTCGTTACCGCCATCGAAAAG
AAAAAGCGCAGCCGCAACCCCGCCGCGCCGTTTACCACATCCACCATGCA
GCAGGATGCCGTGCGTAAACTGGGCTTCACCACCGACCGCACCATGCGTA
CCGCCCAGCAGCTTTACGAAGGTATAGACGTAGGGCAGGGTGCCATCGGT
CTGATTACCTATATGCGTACCGACAGCGTGAATTTGGCTGACGAAGCGTT
AACCGAAATCCGCCATTACATTGAAAACAAAATCGGCAAAGAATATCTGC
CGAGTGCCGCCAAACAATACAAAACCAAATCCAAAAACGCCCAAGAAGCC
CATGAAGCGATCCGCCCGACTTCCGTGTACCGCACGCCCGAAAGCGTCAA
ACCCTTCCTGAGTGCAGACCAGTTCAAACTCTATCAAATGATTTGGCAGC
GTACCGTTGCCTGTCAGATGACGCCCGCCAAATTCGACCAAACCACCGTC
GATATTACCGTCGGCAAAGGCGTGTTCCGAGTAACCGGACAAGTGCAAAC
CTTCGCAGGCTTCCTCAGCGTTTACGAAGAAAGCAGCGACGATGAAGAGA
GCGAAGACAGCAAAAAACTGCCCGAAATGAGCGAAGGCGACAAATTGCCG
GTCGACAAACTCTACGGCGAACAACACTTCACCACCCCGCCGCCGCGCTA
CAACGAAGCCACACTGGTTAAAGCCCTCGAAGAATACGGCATCGGCCGCC
CCTCGACCTACGCCAGCATTATTTCTACGCTCAAAGACCGCGAATACGTT
ACCCTTGAGCAAAAACGCTTCATGCCCACCGACACAGGCGACATCGTCAA
TAAATTCCTGACCGAACACTTCGCCCAATACGTCGATTACCACTTCACCG
CCAAACTCGAAGACCAGCTTGACGAAATCGCCGACGGCAAACGCCGCTGG
ATTCCCGTGATGGACAAATTCTGGAAACCGTTCATCAAACAAGTGGAAGA
AAAAGAGGGCATCGAACGCGCCAAATTCACTACGCAGGAACTTGACGAAA
CCTGCCCGAAATGCGGCGAACACAAACTGCAAATCAAGTTCGGCAAAATG
GGCCGTTTCGTTGCGTGTGCCGGTTATCCCGAGTGCAGTTACACCCGCAA
CGTCAACGAAACCGCCGAAGAAGCTGCCGAACGCATCGCCAAAGCGGAAG
CCGAACAGGTCGAACTCGACGGTCGCGAATGCCCCAAATGCGGCGGACGG
CTGGTGTACAAATACAGCCGCACCGGCAGTAAATTCATCGGTTGCGCCAA
CTACCCCAAATGCAAACACGTCGAGCCGTTGGAAAAACCCAAAGATACCG
GCGTCCAATGCCCGCAATGCAAAAAAGGCAACCTCGTCGAGCGCAAATCC
CGCTACGGCAAACTGTTTTACAGTTGCAGCACCTATCCCGACTGCAACTA
CGCCACTTGGAACCCGCCCGTTGCCGAAGAATGCCCGAACTGCCATTGGC
CGGTACTGGCCATCAAAACTACCAAACGCCGGGGCGTGGAAAAAGTCTGC
CCGCAAAAAGAATGCGGCTGGAAAGAACAAATCGAACCGCCTGCACCGCA
AGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy