Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1481 IGR1479 IGR1480 IGR1478 IGR1483 IGR1482 NG1810 lpxA, - NG1806 truA, - NG1811 pIB, - NG1812 dadA, - NG1808 NG1807 valS, - NG1809 NG1810 lpxA, - NG1806 truA, - NG1811 pIB, - NG1812 dadA, - NG1808 NG1807 valS, - NG1809 NG1810 lpxA, - NG1806 truA, - NG1811 pIB, - NG1812 dadA, - NG1808 NG1807 valS, - NG1809
* Calculated from Protein Sequence

Gene ID: NG1809

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
valS  

Definition:
valyl-tRNA synthetase

Gene Start:
1783145

Gene Stop:
1785979

Gene Length:
2835

Molecular Weight*:
106331

pI*:
5.50

Net Charge*:
-18.02

EC:
6.1.1.9  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Secondary Evidence:
Hartlein,M., Frank,R. and Madern,D.
Nucleotide sequence of Escherichia coli valyl-tRNA synthetase gene
valS
Nucleic Acids Res. 15 (21), 9081-9082 (1987)
Medline: 88067721


Comment:
Oklahoma ID: NGO.1809

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to ValS proteins. Residues 2-943 are 52% similar to Vals from P.aeruginosa (11352829).

Residues 1-945 are 93% similar to SYV_NEIMA (12585347).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0525
COG name: Valyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0525 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 4.1e-09.
    IPB001412A    42-52
    IPB001412B    549-559


ProDom Summary:  Protein Domain Search
Residues 696-818 are 45% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD001183) which is seen in SYV_ECOLI.

Residues 120-197 are 70% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD002670) which is seen in SYV_HAEIN.

Residues 820-943 are 29% similar to a (VALYL-TRNA SYNTHETASE VALINE--TRNA LIGASE VALRS) protein domain (PD004138) which is seen in SYV_BACST.

Residues 608-694 are 55% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000476) which is seen in SYV_ECOLI.

Residues 352-454 are 58% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000647) which is seen in SYV_SYNY3.

Residues 470-537 are 64% similar to a (SYNTHETASE VALYL-TRNA AMINOACYL-TRNA) protein domain (PD002917) which is seen in SYV_SYNY3.

Residues 18-117 are 65% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000389) which is seen in SYV_ECOLI.

Residues 198-352 are 58% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000939) which is seen in SYV_HAEIN.

Residues 608-686 are 44% similar to a (SYNTHETASE AMINOACYL-TRNA VALYL-TRNA VALINE--TRNA LIGASE) protein domain (PD023648) which is seen in Q9Z1Q9_MOUSE.



Paralogs:  Local Blast Search


NG1809 is paralogously related to NG0069 (isoleucyl-tRNA synthetase) (2e-45) and NG0006 (leucyl-tRNA synthetase) (2e-23).


Pfam Summary:  Pfam Search
Residues 13 to 629 (E-value = 7e-265) place NG1809 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
508  
524
coil-coil  
873  
907

PDB Hit:
pdb|1GAX|1GAX-A CRYSTAL STRUCTURE OF THERMUS THERMOPHILUS 664.0 0.000000
pdb|1JZQ|1JZQ-A 209.0 2e-54
pdb|1FFY|1FFY-A INSIGHTS INTO EDITING FROM AN ILE-TRNA 181.0 4e-46
pdb|1H3N|1H3N-A LEUCYL-TRNA SYNTHETASE FROM THERMUS THERMOPHILUS

Gene Protein Sequence:
MLDKYSPAEIESKHYQNWESQGYFRPDMDLTKPSFSIQLPPPNVTGTLHM
GHAFNQTIMDGLTRYYRMKGCNTAWIPGTDHAGIATQIVVERQLAAQNVS
RHDLGREKFLEKVWEWKEVSGGTITQQMRRVGCSADWTREYFTMDGVRAE
TVTEVFVRLYEQGLIYRGKRLVNWDPVLGTAVSDLEVESMEEQGSMWHIR
YPLADNPTEAVIVATTRPETLLGDAAVAVNPEDERYTHLIGKELILPLTG
RTIPVIADEYVEKDFGTGCVKITPAHDFNDYEVGKRHDTRLINVFDLEAK
VLANAEVFNFKGEAQPGFSLPEKYAGLDRFAARKQMVADLQEQGFLVEIK
PHTLMTPKGDRTGSVIEPMLTSQWFVAMSATPNGGEPDNEFKGLSLADKA
KKAVDSGAVRFIPENWVNTYNQWMNNIQDWCISRQLWWGHQIPAWYDEAG
NVYVARNQAEAEKQAGKTGLTREEDVLDTWFSSALVPFSTLGWPSETDEL
KAFLPSNVLVTGYEIIFFWVARMIMMTTHFTGKVPFKAVYIHGIVRDHEG
KKMSKSEGNVIDPVDLIDGIGLDKLLMKRTTGLRKPETAPKVEEATKKLF
PEGIPSMGADALRFTMASYASLGRSVNFDFKRAEGYRNFCNKIWNATNFV
LMNTENQDCGYGATAAEPRGHSFPDMWIIGRLNQTIEQVTQAYETYRFDL
AAETLYSFVWNDYCDWYLELAKVQLQTGCASRQRATRHTLLRVLEAALRL
LHPIIPFITEELWQTVAPMCDAKTADSIMLARFPETDGGEIVQTAFGQMT
VLQDLIGAVRNLRGETGIQPNVKAPLFVESADDLADYLKYLPMMTRLTEA
RQVAALPESGDAPVAVCNGARLMLKVEIDKAAETARLSKEAEKLQKALDK
LNAKLSKPGYTEKAPAHLVEKDKADLAELEDKMAKVQNQLAKLKD

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGACAAATACTCCCCCGCCGAAATCGAATCCAAACACTATCAAAA
CTGGGAAAGCCAAGGCTATTTCCGGCCCGATATGGATTTGACCAAACCGT
CTTTTTCCATCCAACTGCCGCCGCCCAACGTAACCGGCACGCTGCACATG
GGTCATGCCTTCAACCAAACCATCATGGACGGCCTGACCCGCTACTACCG
CATGAAAGGCTGCAACACCGCCTGGATTCCCGGTACCGACCACGCGGGCA
TCGCCACGCAAATCGTGGTCGAGCGTCAGCTTGCCGCGCAAAACGTGTCC
CGTCACGACTTGGGGCGCGAAAAATTCTTGGAAAAAGTGTGGGAGTGGAA
AGAAGTTTCCGGCGGCACGATTACCCAGCAGATGCGCCGCGTGGGCTGCT
CCGCCGACTGGACGCGCGAGTATTTCACGATGGACGGCGTACGCGCCGAA
ACCGTGACCGAAGTGTTCGTGCGCCTGTATGAACAGGGCTTGATTTACCG
CGGCAAACGCTTGGTGAACTGGGATCCCGTGCTTGGCACGGCGGTGTCGG
ATTTGGAAGTGGAAAGCATGGAAGAACAAGGCTCTATGTGGCACATCCGC
TATCCGCTGGCCGACAATCCCACCGAAGCCGTTATCGTGGCGACCACCCG
TCCTGAAACGTTGCTGGGCGACGCGGCCGTTGCCGTCAATCCAGAAGATG
AACGTTACACCCACTTAATCGGCAAAGAATTAATCCTGCCGCTGACCGGT
CGCACCATTCCGGTTATCGCCGACGAATACGTTGAAAAAGACTTCGGTAC
CGGTTGCGTGAAAATCACGCCTGCGCACGATTTCAACGATTACGAAGTCG
GCAAACGCCACGACACGCGCCTGATTAACGTGTTCGACTTAGAAGCCAAA
GTGCTGGCAAACGCCGAAGTGTTCAACTTCAAAGGCGAAGCGCAACCAGG
CTTTTCCCTGCCTGAAAAATACGCAGGCTTGGACCGCTTTGCCGCGCGCA
AACAAATGGTTGCCGATTTGCAGGAGCAAGGCTTCTTGGTCGAAATCAAA
CCGCACACGCTGATGACGCCGAAAGGCGACCGCACAGGTTCAGTGATTGA
GCCGATGCTGACCAGCCAATGGTTTGTCGCCATGTCCGCCACACCGAACG
GCGGCGAGCCTGACAACGAATTCAAAGGCTTGAGCCTTGCCGACAAAGCC
AAAAAAGCCGTCGACAGCGGCGCGGTGCGCTTTATCCCTGAAAACTGGGT
CAATACCTACAACCAATGGATGAACAACATCCAAGACTGGTGTATTTCGC
GCCAACTGTGGTGGGGGCATCAAATCCCCGCGTGGTACGACGAAGCAGGT
AATGTTTACGTCGCCCGCAATCAGGCTGAAGCCGAAAAACAAGCCGGCAA
AACAGGTTTGACCCGCGAAGAAGACGTATTGGACACATGGTTCTCCTCCG
CGCTCGTGCCGTTCTCCACGCTCGGCTGGCCGTCTGAAACCGACGAGCTC
AAAGCCTTCCTGCCGTCCAACGTCTTGGTTACCGGCTACGAAATCATCTT
CTTCTGGGTGGCGCGCATGATTATGATGACCACCCACTTCACCGGCAAAG
TACCGTTTAAAGCCGTGTACATCCACGGCATCGTGCGCGACCACGAAGGC
AAAAAAATGTCCAAATCCGAAGGCAACGTCATCGACCCTGTGGATTTGAT
CGATGGTATCGGCTTGGACAAGCTGCTGATGAAACGTACGACCGGCCTGC
GCAAACCCGAAACCGCGCCGAAAGTGGAAGAAGCCACGAAAAAACTCTTC
CCCGAAGGTATCCCCAGCATGGGCGCGGACGCATTGCGCTTCACCATGGC
GAGCTACGCCAGCTTGGGCCGTTCGGTTAACTTCGACTTCAAACGCGCCG
AAGGCTACCGCAACTTCTGCAACAAAATCTGGAACGCCACCAACTTCGTC
TTGATGAACACCGAAAACCAAGACTGCGGCTACGGCGCAACCGCTGCCGA
ACCGCGCGGCCATTCCTTCCCCGATATGTGGATCATAGGTCGTCTGAATC
AGACCATCGAGCAGGTTACGCAAGCCTACGAAACCTACCGCTTTGATTTG
GCGGCGGAAACCCTGTACAGCTTCGTATGGAACGATTATTGCGACTGGTA
TCTGGAACTCGCCAAAGTACAGCTCCAAACCGGCTGCGCCAGCCGTCAGC
GCGCCACACGCCATACCTTATTGCGCGTACTCGAAGCCGCCCTGCGCCTG
CTGCACCCGATTATCCCGTTCATCACCGAAGAACTGTGGCAAACCGTCGC
CCCCATGTGCGATGCCAAAACCGCCGACAGCATCATGCTCGCCCGTTTCC
CCGAAACCGACGGCGGCGAGATTGTTCAGACGGCATTCGGGCAAATGACC
GTGTTGCAGGATTTGATCGGCGCAGTCCGCAACCTGCGCGGCGAAACGGG
CATCCAGCCCAACGTGAAAGCCCCGCTGTTTGTCGAAAGCGCGGACGACT
TGGCGGACTACCTCAAATACCTGCCGATGATGACCCGCCTGACCGAAGCA
CGGCAAGTCGCCGCCCTGCCCGAAAGCGGAGACGCGCCCGTCGCCGTCTG
CAACGGCGCGCGCCTGATGCTGAAAGTCGAAATCGACAAAGCCGCCGAAA
CCGCCCGTTTGAGCAAAGAAGCCGAGAAGCTGCAAAAAGCCTTGGACAAA
CTCAATGCCAAACTCTCCAAACCCGGCTACACCGAAAAAGCCCCGGCGCA
TCTGGTGGAAAAAGACAAAGCCGATTTGGCGGAATTGGAAGACAAAATGG
CGAAAGTGCAAAATCAGTTGGCGAAGTTGAAAGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy