Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1475 IGR1477 IGR1481 IGR1479 IGR1480 IGR1476 IGR1478 IGR1482 fabZ, - NG1804 NG1810 NG1805 lpxA, - NG1806 truA, - NG1811 lpxD, - NG1803 dadA, - NG1808 NG1807 valS, - NG1809 fabZ, - NG1804 NG1810 NG1805 lpxA, - NG1806 truA, - NG1811 lpxD, - NG1803 dadA, - NG1808 NG1807 valS, - NG1809 NG1810 NG1805 lpxA, - NG1806 lpxD, - NG1803 dadA, - NG1808 NG1807 valS, - NG1809 fabZ, - NG1804
* Calculated from Protein Sequence

Gene ID: NG1808

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dadA  

Definition:
D-amino acid dehydrogenase small subunit (DadA)

Gene Start:
1781781

Gene Stop:
1783037

Gene Length:
1257

Molecular Weight*:
46833

pI*:
8.00

Net Charge*:
2.95

EC:
1.4.99.1  

Functional Class:
Energy metabolism; Amino acids and amines  

Pathway: pathway table
Nitrogen metabolism
Phenylalanine metabolism

Secondary Evidence:
Lobocka,M., Hennig,J., Wild,J. and Klopotowski,T.
Organization and expression of the Escherichia coli K-12 dad operon encoding the smaller subunit of D-amino acid dehydrogenase and the catabolic alanine racemase
J. Bacteriol. 176 (5), 1500-1510 (1994)
Medline: 94156858


Comment:
For other 'dad' genes see NG0809 (dad) and NG1295 (dadX).

Oklahoma ID: NGO.1808

See NG1295 for associated alanine racemase (dadX).

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to DadA proteins. Residues 17-418 are 54% similar to DADA_ECOLI (118227).

Residues 1-417 are 92% similar to NMB0176 in N.meningitidis (11353117).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0665
COG name: Predicted oxidoreductases
Functional Class:  R
The phylogenetic pattern of COG0665 is amtKyq-CEBRhuj--o-in-
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB000927 (D-amino acid oxidase) with a combined E-value of 1.5e-08.
    IPB000927A    2-14
    IPB000927B    184-227
    IPB000927E    374-398
***** IPB000171 (Bacterial-type phytoene dehydrogenase) with a combined E-value of 9.1e-08.
    IPB000171A    4-34
    IPB000171D    235-255


ProDom Summary:  Protein Domain Search
Residues 50-213 are 51% similar to a (D-AMINO ACID DEHYDROGENASE SMALL) protein domain (PD036929) which is seen in DADA_ECOLI.

Residues 215-416 are 55% similar to a (OXIDOREDUCTASE OXIDASE FLAVOPROTEIN FAD ACID PROTEIN) protein domain (PD001376) which is seen in DADA_ECOLI.



Paralogs:  Local Blast Search


NG1808 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 404 (E-value = 3.3e-05) place NG1808 in the DAO family which is described as FAD dependent oxidoreductase (PF01266)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
22
transmembrane  
248  
264

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKVLVLGAGVAGVSSVWYLAEAGHEVTVIDRTEGVAMETSFANAGQLSYG
YTTPWAAPGIPTKALKRLFKSHPPLLFRPDGGLYQIEWLWRMLQNCTATR
YQINKERMVRISEYSREMFRRFEAQTDMNFEGRKKGTLQIFRQTEEVEAA
KQDIAVLERYGVPYRRLKPEECAEFEPALARVTAKIVGGLHLPADATGDC
RLFTENLYKLCQEKGVRFYFNQTISRIDHNGLRIKAVETETGRFETDAVV
CALGCFSRTVLAQLDLNLPIYPVKGYSLTLPVTNSDGAPVSTVLDESYKV
AITRFDNRIRVGGMAELSGYETKLPEKRRETLALVVNDLFPEGGDLSQAL
SWSGLRPMTPDSTPLIGRTRFENLFLNTGHGTLGWTMSPGSAKLTADIVS
GKDTEIRSDDLSLSRYQKL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTGCTTGTTTTAGGTGCGGGTGTTGCCGGCGTATCCTCCGTGTG
GTATCTGGCAGAGGCCGGACATGAAGTAACGGTCATCGACCGCACCGAGG
GTGTGGCGATGGAAACCAGTTTTGCCAATGCAGGCCAGCTTTCTTACGGC
TATACCACGCCTTGGGCTGCACCCGGTATTCCGACCAAAGCACTGAAACG
GCTGTTTAAAAGCCATCCGCCTTTACTGTTCCGCCCTGACGGCGGCCTGT
ATCAAATCGAATGGCTGTGGCGGATGCTGCAAAACTGCACGGCAACGCGC
TATCAAATCAATAAAGAGCGCATGGTCAGGATTTCCGAATACAGCCGTGA
AATGTTCCGCCGTTTTGAAGCGCAAACCGACATGAATTTTGAGGGACGCA
AAAAAGGGACGTTGCAGATTTTCCGCCAAACCGAAGAAGTCGAAGCGGCA
AAACAAGACATTGCCGTTTTGGAACGCTACGGCGTGCCGTACCGCCGTCT
GAAGCCCGAAGAATGCGCAGAATTCGAGCCTGCGCTGGCACGCGTTACCG
CCAAAATTGTCGGCGGTCTGCACCTGCCTGCGGATGCGACCGGCGACTGC
CGCCTCTTCACCGAAAACCTGTACAAATTGTGTCAAGAGAAGGGCGTACG
GTTCTACTTCAACCAAACCATCAGCCGCATCGACCACAACGGGCTGCGCA
TCAAAGCCGTTGAAACCGAAACAGGGCGGTTTGAAACAGATGCCGTTGTC
TGCGCGCTCGGCTGCTTCAGCAGGACTGTGTTGGCGCAGTTGGATCTCAA
TCTGCCCATTTATCCCGTCAAAGGCTATTCCTTGACCCTGCCGGTCACAA
ATTCCGACGGCGCACCGGTGTCCACTGTTTTAGATGAAAGCTACAAAGTC
GCCATCACGCGTTTTGACAACAGAATCCGCGTCGGCGGAATGGCGGAATT
GTCCGGCTACGAAACCAAACTGCCCGAAAAACGCCGCGAAACCTTGGCTT
TGGTCGTCAACGACTTGTTCCCGGAAGGCGGCGATTTGAGCCAAGCATTG
TCCTGGAGCGGCCTCAGGCCGATGACGCCCGACAGTACGCCGTTAATCGG
GCGCACCCGCTTTGAAAACCTGTTTCTGAATACCGGGCACGGTACTTTGG
GCTGGACCATGTCGCCGGGTTCGGCAAAATTGACCGCCGATATCGTGAGC
GGCAAAGACACCGAAATCCGCAGCGACGATTTGAGCCTGTCGCGCTATCA
AAAACTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy