Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1473 IGR1474 IGR1475 IGR1477 IGR1479 IGR1480 IGR1476 IGR1478 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dadA, - NG1808 NG1807 omp85, - NG1801 valS, - NG1809 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dadA, - NG1808 NG1807 omp85, - NG1801 valS, - NG1809 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dadA, - NG1808 NG1807 omp85, - NG1801 valS, - NG1809
* Calculated from Protein Sequence

Gene ID: NG1806

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lpxA  

Definition:
acyl-UDP-N-acetylglucosamine O-acyltransferase (LpxA) [acyl-carrier protein]

Gene Start:
1779072

Gene Stop:
1779845

Gene Length:
774

Molecular Weight*:
28157

pI*:
6.60

Net Charge*:
-1.97

EC:
2.3.1.129  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Secondary Evidence:
Coleman,J. and Raetz,C.R.
First committed step of lipid A biosynthesis in Escherichia coli:
sequence of the lpxA gene
J. Bacteriol. 170 (3), 1268-1274 (1988)
Medline: 88139188

Crowell,D.N., Reznikoff,W.S. and Raetz,C.R.
Nucleotide sequence of the Escherichia coli gene for lipid A
disaccharide synthase
J. Bacteriol. 169 (12), 5727-5734 (1987)
Medline: 88058790



Comment:
For other 'lpx' genes see NG0242 (lpxK),NG1782 (lpxB), NG1803 (lpxD)and NG2065 (lpxC).

Oklahoma ID: NGO.1806

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to acyl-UDP-N-acetylglucosamine O-acyltransferase (LpxA) [acyl-carrier protein]. Residues 4-258 are 49% similar to LPXA_ECOLI (2506337).

Residues 1-258 are 97% similar to NMB0178 in N.meningitidis (11257853).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1043
COG name: Acyl-[acyl carrier protein]--UDP-N-acetylglucosamine O-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG1043 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001451 (Bacterial transferase hexapeptide repeat) with a combined E-value of 2.6e-09.
    IPB001451    143-178
    IPB001451    22-57
    IPB001451    16-51
    IPB001451    125-160
    IPB001451    28-63
    IPB001451    10-45
    IPB001451    4-39
    IPB001451    107-142
    IPB001451    119-154
    IPB001451    113-148
    IPB001451    34-69
    IPB001451    101-136
    IPB001451    131-166


ProDom Summary:  Protein Domain Search
Residues 192-258 are 97% similar to a (ACYLTRANSFERASE TRANSFERASE) protein domain (PD007405) which is seen in P95379_NEIME.

Residues 1-88 are 96% similar to a (ACYLTRANSFERASE TRANSFERASE) protein domain (PD004893) which is seen in P95379_NEIME.

Residues 97-188 are 47% similar to a (TRANSFERASE ACYLTRANSFERASE PROTEIN REPEAT BIOSYNTHESIS) protein domain (PD000343) which is seen in LPXA_AQUAE.



Paralogs:  Local Blast Search


NG1806 is paralogously related to NG1803 (UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase) (4e-13), NG2053 (UDP-N-acetylglucosamine pyrophosphorylase) (4e-04) and NG2125 (possible acetyltransferase) (8e-04).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1LXA|1LXA UDP N-ACETYLGLUCOSAMINE ACYLTRANSFERASE 273.0 2e-74
pdb|1KQA|1KQA-A GALACTOSIDE ACETYLTRANSFERASE IN COMPLEX WITH 147.0 2e-36
pdb|1KHR|1KHR-A CRYSTAL STRUCTURE OF VAT(D) IN COMPLEX WITH 55.5 1e-08
pdb|1HM0|1HM0-A CRYS

Gene Protein Sequence:
MTLIHPTAVIDPKAELDSGVKVGAYTVIGPNVRIGANTEIGPHAVINGHT
TIGENNRIFQFASLGEIPQDKKYRDEPTKLIIGNGNTIREFTTFNLGTVT
GIGETRIGDDNWIMAYCHLAHDCVVGNHTIFANNASLAGHVTVGDYVVLG
GYTLVFQFCRIGDYAMTAFAAGVHKDVPPYFMASGYRAEPAGLNSEGMRR
NGFTAEQISAVKDVYKTLYHRGIPFEEAKADILRRAETQAELAVFQDFFA
QSTRGIIR

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCTCATCCACCCGACCGCCGTCATCGACCCCAAAGCCGAACTCGA
CTCCGGCGTCAAAGTCGGCGCGTACACCGTCATCGGCCCCAACGTCCGAA
TCGGTGCGAATACAGAAATCGGTCCGCACGCCGTCATCAACGGCCACACC
ACCATCGGCGAAAACAACCGCATTTTCCAATTTGCCAGCCTCGGCGAAAT
TCCGCAGGACAAAAAATACCGCGACGAGCCGACCAAGCTGATTATCGGCA
ACGGCAACACCATCCGCGAATTCACCACCTTTAATTTAGGCACGGTAACC
GGCATCGGCGAAACCCGTATCGGCGACGACAACTGGATTATGGCGTACTG
CCACCTCGCGCACGACTGCGTGGTCGGCAACCACACCATTTTCGCCAACA
ACGCCTCGCTTGCCGGACACGTTACCGTCGGCGACTACGTCGTTTTGGGC
GGCTACACGCTGGTCTTCCAATTCTGCCGCATCGGCGACTACGCCATGAC
CGCCTTCGCCGCAGGCGTACACAAAGACGTGCCGCCCTACTTTATGGCAT
CGGGCTACCGCGCCGAACCGGCCGGCCTAAACAGCGAAGGTATGCGCCGC
AACGGTTTTACCGCAGAACAGATTTCCGCCGTCAAAGACGTATACAAAAC
CCTCTACCATCGCGGCATTCCGTTTGAAGAAGCCAAGGCGGACATTCTCC
GCCGCGCCGAAACCCAAGCCGAGCTTGCCGTATTTCAAGACTTCTTCGCA
CAATCGACGCGCGGCATCATCCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy