Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1473 IGR1474 IGR1475 IGR1477 IGR1472 IGR1479 IGR1476 IGR1478 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dadA, - NG1808 NG1800 NG1807 omp85, - NG1801 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dadA, - NG1808 NG1800 NG1807 omp85, - NG1801 fabZ, - NG1804 ompH, - NG1802 NG1805 lpxA, - NG1806 lpxD, - NG1803 dadA, - NG1808 NG1800 NG1807 omp85, - NG1801
* Calculated from Protein Sequence

Gene ID: NG1804

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabZ  

Definition:
(3R)-hydroxymyristoyl-acyl carrier protein dehydrase

Gene Start:
1777687

Gene Stop:
1778133

Gene Length:
447

Molecular Weight*:
16597

pI*:
6.50

Net Charge*:
-0.62

EC:
4.2.1.-  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Bile acid biosynthesis
Butanoate metabolism
Cyanoamino acid metabolism
Fructose and mannose metabolism
Phenylalanine metabolism
Tetrachloroethene degradation
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Primary Evidence:
Steeghs,L., Jennings,M.P., Poolman,J.T. and van der Ley,P.
Isolation and characterization of the Neisseria meningitidis
lpxD-fabZ-lpxA gene cluster involved in lipid A biosynthesis
Gene 190 (2), 263-270 (1997)
Medline: 97341069


Secondary Evidence:
Mohan,S., Kelly,T.M., Eveland,S.S., Raetz,C.R. and Anderson,M.S.
An Escherichia coli gene (FabZ) encoding (3R)-hydroxymyristoyl acyl carrier protein dehydrase. Relation to fabA and suppression of mutations in lipid A biosynthesis
J. Biol. Chem. 269 (52), 32896-32903 (1994)
Medline: 95105173

Coleman,J. and Raetz,C.R.
First committed step of lipid A biosynthesis in Escherichia coli:
sequence of the lpxA gene
J. Bacteriol. 170 (3), 1268-1274 (1988)
Medline: 88139188


Comment:
For other 'Fab' genes see NG1666 (FabI),NG1763 (fabF),NG1352 (fabF2), NG2163 (fabG), NG2166 (fabD) and NG2168 (fabH).

Oklahoma ID: NGO.1804

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratases. Residues 11-147 are 61% similar to the enzyme in V.cholerae (11279582).

Residues 1-149 are virtually identical to NMB0179 in N.meningitidis (11279585).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0764
COG name: 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases
Functional Class:  I
The phylogenetic pattern of COG0764 is -----qvcEB-Huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001143 (Bacterial thioester dehydrase) with a combined E-value of 4.1e-80.
    IPB001143A    11-24
    IPB001143B    27-80
    IPB001143C    90-132


ProDom Summary:  Protein Domain Search
Residues 7-137 are identical to a (PROTEIN DEHYDRATASE CARRIER) protein domain (PD005671) which is seen in P95378_NEIME.



Paralogs:  Local Blast Search


NG1804 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 51 to 140 (E-value = 5.2e-19) place NG1804 in the 4HBT family which is described as Thioesterase superfamily (PF03061)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
63  
79

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MDVQLPIEAKDIQKLIPHRYPFLQLDRITAFEPMKTLTAIKNVTINEPQF
QGHFPDLPVMPGVLIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARF
KRQVIPGDQLVFEVELLTSRRGIGKFNAVAKVDGQVAVEAVIMCAKRVV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACGTACAACTCCCCATCGAAGCCAAAGACATCCAAAAACTCATCCC
CCACCGCTACCCGTTTCTCCAGCTCGACCGCATTACCGCCTTCGAGCCGA
TGAAAACCCTGACCGCCATCAAAAACGTAACCATAAACGAACCCCAATTC
CAAGGCCATTTCCCCGACCTGCCCGTTATGCCCGGCGTACTCATCATCGA
AGCGATGGCGCAGGCGTGCGGCACGTTGGCGATTTTGAGCGAAGGCGGGC
GCAAGGAAAACGAATTTTTCTTCTTCGCCGGCATAGACGAAGCCCGTTTC
AAACGCCAAGTCATCCCCGGCGACCAACTCGTCTTTGAAGTCGAACTCCT
GACCAGCCGGCGCGGCATCGGCAAATTCAACGCCGTTGCCAAAGTGGACG
GACAAGTCGCCGTCGAAGCCGTGATTATGTGCGCCAAACGCGTGGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy